SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008816 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008816
Domain Number 1 Region: 1216-1377
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-72
Family Pleckstrin-homology domain (PH domain) 0.0000000634
Further Details:      
 
Domain Number 2 Region: 1014-1215
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-51
Family DBL homology domain (DH-domain) 0.00000000609
Further Details:      
 
Domain Number 3 Region: 460-582
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-18
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 840-919
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000012
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008816   Gene: ENSSHAG00000007634   Transcript: ENSSHAT00000008889
Sequence length 1420
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849535.1:337439:447394:1 gene:ENSSHAG00000007634 transcript:ENSSHAT00000008889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTESQNVEHRFYGEKQGNLSRKHTSHSLRLSNKTRRMRHASSARVIHRNSEVSTRSSS
TPSIPQSLAENGMEPFSQEGKLEDFGSPIWVGRVGMGLRPVSCHTDSSITPSIDSSTILT
AASAQSMPDSEENRLYGNDSTYLPEGGRRQRPYTTNGTTFMETSSFKKKRSKSADIWRED
SLEFSLSDLSQEHLTSNEEILGSVEERDRGEDRGMEARDASQQLSTCHRANSLGVLYIPQ
NNGVKANHGPRSKFVGYCGNLMSDVPDLANRKMPSAVAEDTPPYSNYNTLPCRKSHCLSE
GATNSQISHSNSMQGRRAKTTQDVNIGEGSEFADSGIEGATIDTDLLSRRSNATNSSYSP
TTSRAFLGSDSGSSSTGDAARQGVYENFRRELEMSTNNSESLEEAGSAHSDEQSSGTLSS
LGQSDILLSAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYES
DGRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTISQTELENWI
TAIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGDMQLSSVTDSKKKKT
ILDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSV
SSFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEG
DDTIKKSLEGIYDDTVPDGKREKEVVLSSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALI
VVHPGDTARDILELICKVHQLGHAIHYLRLKFLIDNKMQYYVPKPEEDIYELLYQEIEIC
PKITRNIQIEKSDASNDNYGFSISSVEEEGVQRLYVNNVKETGLASKKGLKTGDEILEIN
NIAADTLNSSMLKDVLTQLSLCLIVQTYPELVGGQKLLESPPHRVDSLSDFSENPFAFLT
KNPGNSLCSEQVRSAEMTPEETDVRDLESSDESDKTNKECTGPQLVTMRQLTDADKLRKV
ICELLETERTYVKDLNCLMESYLKPLQKETFLTQDELDVLFGNLMEMVAFQVEFLKTLED
GVRLVPDLDKLERVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKARTDTA
FKAFLDAQNPEQQHSSTLESYLIKPIQRILKYPLLLKELFALTDEASEEHSYLDVAIKTM
NKVASHINEMQKIHEEFGAVFDQLIAEQMGEKKEVADLSMGDLLLHTTVIWLNPPASLGK
WKKEPELAAFVFKMAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQIRA
LTSADAEANSVCEIVHVKSESEGRPERSFHLCCSSPESGKDFLKAVQSILRDKHRRQLLK
TESLPSSQQYVPFGGKRLYTLKGARPAMSRAAMSKRHSVL
Download sequence
Identical sequences G3W061
ENSSHAP00000008816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]