SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008842 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008842
Domain Number 1 Region: 844-951
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000424
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 950-1077
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000722
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 3 Region: 640-779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000091
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 561-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 5 Region: 808-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 6 Region: 766-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000587
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008842   Gene: ENSSHAG00000007657   Transcript: ENSSHAT00000008915
Sequence length 1188
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841601.1:340282:481841:1 gene:ENSSHAG00000007657 transcript:ENSSHAT00000008915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGKVPEGQSYFVDFGSTECSCPKGGGKISCQFMLCPDLPPNCIDAVIPTDGCPQCGRIG
CLHEGEKYVAGHTVRMPHCKVCHCPNSGGELICYQLPGCDASAFHSPSNLSDHEENDPER
HYDDPYSYDQEASEGDVAQVESPTKGWAVPGAQPAGNLGSLERLEQQSEDTNMIATHNTT
IAGFAQLISPTKQAAAVVMDAKVPSPSRTRSVMEQKEKGVVEEEEEEEEEEEGEDGGYID
PSTALEVNERAGKAGSITEKSEEGQTSNNAVESEDRAQERDQERDRAEPEGNIIPDAQSN
PRDRGRDGERSPGIGFQEVMPTERSVPQPAQGGQVEKTIPKVKFTPSTLPPVALQEDPTE
ETPKQSQTLYHYPSQEKIDPNSIHSDPRSQEGSTKDLIETCCAAGQQWAIDNAECTEIPV
SGADGDVCRIAQKQCCISYLKENSCVAGMVGAKEGEICGPEENDTCGVSLYKQCCDCCAL
GLKVKSEGQMCESNPNLGYPCNHVMLSCCEGEDHLIVPEVRKPPEPLPTVTPEKVSETEN
HHAALSINQESELSNSLPGDDRDECLLYPGELCQHLCINTVGSYKCACFPRFTLQEDGLS
CLPDSEVMKPNTGEEGPLAPETPHSQPEVMRMPQPVPNTCKDNGPCKQVCNVIDNRAMCS
CFPGYAIMADGVSCEDMDECLRGAHDCTRRQFCVNTLGSFYCVNHTVICAEGFILNMHRK
CVDINECVTDTHTCSRGEHCVNTVGSFHCYKDLNCESGYELKEGECVDIDECTQGTHSCK
VNFVCQNTQGSFYCESKQRCMDGFLQDPEGNCVDINECTSLPEPCKPGFNCINTVGSYTC
QRNQLLCTRGYHSSEDGSKCVDVNECETGVHRCGEGQVCHNLPGTYRCDCKMGYQYDAFS
RACVDVNECWSYPGRLCQHACENTPGSYRCSCSSGFQLAFDGKHCEDVNECENNPCSQEC
ANVYGSYQCYCRQGYQLAEDGHACKDIDECTQSAGILCTFRCLNVPGSYQCACPEQGYTM
MANGRTCRDLDECTLGTHNCSAAETCYNIQGSFRCLLFECPPNYRKVSDTRCERTSCFNF
LDCQSTPVRITYYQLNFQTNIVVPAHIFRIGPSPAYTGDNIILTITKGNEENYFSAQKLN
PYTGVVFIQRPVKEPQDFLLDVEMKLWRQGTYTTFLAKIYIFITAHAF
Download sequence
Identical sequences G3W087
ENSSHAP00000008842 ENSSHAP00000008842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]