SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008906 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008906
Domain Number 1 Region: 136-208
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000209
Family VWC domain 0.019
Further Details:      
 
Domain Number 2 Region: 3-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 42-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000305
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008906   Gene: ENSSHAG00000007712   Transcript: ENSSHAT00000008979
Sequence length 264
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864885.1:345607:395709:1 gene:ENSSHAG00000007712 transcript:ENSSHAT00000008979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EADIDECTEGIIECHNHSRCVNLPGWYHCECRSGFHDNGTYSLSGESCIDIDECALRTHT
CWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKRNGQVWTLKEDRCSVCSCKDGKIFC
RRTACDCQNPSVDLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTYSCQQCRCMEGEVDCW
PLTCPSLSCEYTAVSEGECCPRCVSDPCLADNIAYDIRKTCLDSYGVTRLSGAIWTMAGS
PCTTCKCKNGSVCCSVDLECLHNN
Download sequence
Identical sequences G3W0F1
ENSSHAP00000008906 ENSSHAP00000008906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]