SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009013 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009013
Domain Number 1 Region: 2-535
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.44e-175
Family Motor proteins 0.0000000143
Further Details:      
 
Domain Number 2 Region: 940-1036
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-28
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1119-1238
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1522-1591,1634-1678
Classification Level Classification E-value
Superfamily Second domain of FERM 9.65e-20
Family Second domain of FERM 0.0072
Further Details:      
 
Domain Number 5 Region: 1057-1111
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000171
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 900-940
Classification Level Classification E-value
Superfamily PH domain-like 0.000000121
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009013   Gene: ENSSHAG00000007802   Transcript: ENSSHAT00000009087
Sequence length 1789
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841214.1:354506:473653:-1 gene:ENSSHAG00000007802 transcript:ENSSHAT00000009087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYALLAGLENKEKEEFYLSMPENYHYLNQSGCVADATINDKESFKDVITAMEVMQFSKE
EVREILRLLAGILHLGNIEFITAGGAQVSFKTALGRSAELLGLDSTQLTDALTQRSMILR
GEEILTPLNIQQAADSRDSMAMALYSQCFAWIIKKINSRIKGKDDFKSIGILDIFGFENF
EVNHFEQFSINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGECLDLIEKKLG
LLALINEESHFPQATDTTLLEKLHSQHAHNHFYVKPRVAVNNFGVKHYAGEVQYDVRGIL
EKNRDTFRDDLLNLLRESRLDFIYDLFEHVSSRNNQETLKCGSKHKRPTVSSQFKDSLHS
LMATLSTSNPFFVRCIKPNMQKMPDQFDQALVLNQLKYSGMLETVRIRKAGFPVRRPFQD
FYKRYKVLMRNLTLPEDVKGKCTVLLHHYDDTNSEWQLGKTKVFLRESLEQKLEKQREKE
VFQAAMVIRAHILGYLARKHYRKVLYHIVIIQKNYRAFLMRRRFLCLKKAAVVFQKQLRG
QIARRVYRQMLEEKRIQEEKRKKEEQEREKERKRQEAELLAQKAEEARRREELEARQKEE
QLKLEMEKQKENKQVEEILRLEKEIEDLQRVKERQELSLTEASLQRLQELRDQELRRLED
EACRAAQEFLESLNFDEIDECVRNIERSLSVGSGFSAELAGDACEEKPDFNFSQPYPEEE
VDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSADSTAQ
LTPSVHDSASLHNSSSGESTYCVPQSSGELISPEGDYDYDQDDYEDGAITSGSSVTFSNS
HSSQWSPDYRYSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSC
VSLPYFHSFLYMKGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRR
NWKKRWFVLRQSKLMYFENDSEEKLKGTIEVRTAKEIIDNTSKENGIDIIMADRVFHLIA
ESPEDASHWFSVLSQVHASTDQEIREMHDEQANPQNAVGTLDVGLIDSVCASDNPDRPNS
FVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSL
KLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRK
HCYRLYTKLLNEATRWSSAIQNVTETKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPI
LRYTNHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGI
LQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFH
LKRIREQFPGTEMEKYAAFVYESLKKTKCREFVPSRDEIEALINRQEMTSIVYCHGGGSC
KITVNSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGTADKAIESRTIVADVLAKFEKLT
ATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIRGHYPAPEENLQVLAA
LRLQYLQGDYTMHTPFPALEEVYPLQRLKSRITQSTKTFPTLERMERRRTSFLEGTLRRS
FRTGSISRQKMEEEQMLDMWIKEEVSSARASIIDKWKKLQGLNQEQAMAKYMALIKEWPG
YGSTLFDVECKEGGFPQELWLGVSAEAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKI
VVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTSRSVSSHESQGSSR
Download sequence
Identical sequences G3W0Q8
ENSSHAP00000009013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]