SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009146 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009146
Domain Number 1 Region: 270-388
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.91e-24
Family PWWP domain 0.008
Further Details:      
 
Domain Number 2 Region: 134-263
Classification Level Classification E-value
Superfamily Bromodomain 9.16e-18
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 3 Region: 86-151
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000209
Family PHD domain 0.015
Further Details:      
 
Domain Number 4 Region: 557-600
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000113
Family MYND zinc finger 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009146   Gene: ENSSHAG00000007920   Transcript: ENSSHAT00000009224
Sequence length 602
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861672.1:367579:448489:1 gene:ENSSHAG00000007920 transcript:ENSSHAT00000009224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFR
VYHSKCLSDEFRLRDSSSHWQCPVCRSIKKKNTSKQEMSTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADI
ARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKITQEPRAKKGRRNQSVEPKKEEPEPETEAVSS
SQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQNMCHDKYTKIFNDFKD
RMKSDHKRETERVVREALEKLRTEMEEEKRQAVNKAVANMQSEMDRKCKQVKEKCKEEFV
EEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRR
KR
Download sequence
Identical sequences G3W141
ENSSHAP00000009146 ENSSHAP00000009146 XP_003771860.1.9362 XP_012406640.1.9362 XP_012406641.1.9362 XP_012406643.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]