SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009257 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009257
Domain Number 1 Region: 331-511
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.64e-39
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 159-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.7e-27
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 3 Region: 8-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-23
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 540-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009257   Gene: ENSSHAG00000008013   Transcript: ENSSHAT00000009337
Sequence length 579
Comment pep:novel scaffold:DEVIL7.0:GL864914.1:376991:411590:1 gene:ENSSHAG00000008013 transcript:ENSSHAT00000009337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGGHGAARADYFAMELLDGYLYLLLDMGSGGIKLRASNRKVNDGEWCHVDFQRDGRKGSI
SVNSRSTPFLASGESEILDLESELYLGGLPEGGRTDLPLPPEVWTAALRAGYVGCVRDLF
IDGRQMPSHPIAASCPSKCRPPPSGSILPPFSCSPPTLHPRSLPPWSRPRCTSPTPLSPA
SPPARDMKIMLPTAMHTEAEDVSLRFMSQRAYGLMMATTSKESADTLRLELDGGQMKLTV
NLGKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGAGQMAGAHTRLEFHNIE
TGIMTERRFISVVPSNFIGHLSGLLFNGQPYMDQCKDGDITYCELNARFGLRAIVADPVT
FKSRASYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDL
GNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYI
GGLSKNMFNNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIGQVERGCDVLLGPST
TCTKDSCANQGVCLQQWDGFTCDCTMTSYGGPICNDREL
Download sequence
Identical sequences G3W1F2
ENSSHAP00000009257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]