SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009298 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009298
Domain Number 1 Region: 42-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 138-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000373
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 239-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000479
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 99-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000709
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 197-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000616
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009298   Gene: ENSSHAG00000008046   Transcript: ENSSHAT00000009378
Sequence length 800
Comment pep:novel scaffold:DEVIL7.0:GL841657.1:377723:415997:-1 gene:ENSSHAG00000008046 transcript:ENSSHAT00000009378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKCADSTVCPPYSICINTPGSYRCNCKPGFVMMKNQKRYKDDIYFCLDVDECSENPHRCG
PNTQCTNTFGSYICSCLSGFSSPSGNSWKPGKTRPFQCTDQDECADSTVCPSYSICINTP
GNYTCNCKRGFLMMKSHDNRMECQDVDECSENPFRCGPNTKCTNTFGSYICRCLYGFSSP
SGNSWKPGNISCQDITSNNCLDPMTCPNNSRCTDTGKGYYCSCNPGFALASGERIFTDPD
EKCEDVDECSENPFRCGPNTKCTNIFGSYTCSCLSGFSSPNGTSWKPGRTGPFQCTVHLF
SHCKNNIFTPKKYNTSQQQGTLLSSAKTSSCTDVDSPPAPKSRKVCIPMTEKNKQTNKKK
TFQRVTSFVRETREGKEQKLSELKVVICSGIKSTFFCFFWRGSMNFDTSYLRDFIPLEYP
LLNHTSRKNFVRLKTAGRGFIQGLGCSIKASEHLFCSGYAILTVLSHQILITQNIIKSSE
KDLTNTEIKMTKNTDLIGGLSSGEKRFGFQKYIGVLGQCCKVSQKNLSPNKSRGKSPKSR
GKDFIIPPITGGLKFQKVSCNELAAIRLLIVIQFLTANASPYGPPRHWIFGGFFFFSPNI
LCSASLLSANIRVIRAFLPFSLTITHTHTYTHNLRVSNIAQSLILQSNSYSAFPSCWLNT
DTGFIWSFLGPVCTIIMINSILLAWTLWILRKKLSSVNAEVSTLKDNRLLTFKAFAQLFI
LGCSWILGIFQIGPIARTMAYLFTIINSLQGTFIFIIHCVLNRQVREEYKKCFTGKVKSS
TISQSSGILLSSVPSTSKMG
Download sequence
Identical sequences G3W1J3
ENSSHAP00000009298 ENSSHAP00000009298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]