SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009323 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009323
Domain Number 1 Region: 500-630
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-21
Family DBL homology domain (DH-domain) 0.0039
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily F-box domain 4.19e-18
Family F-box domain 0.001
Further Details:      
 
Domain Number 3 Region: 661-760
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000189
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009323   Gene: ENSSHAG00000008064   Transcript: ENSSHAT00000009404
Sequence length 762
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856955.1:407019:454809:1 gene:ENSSHAG00000008064 transcript:ENSSHAT00000009404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPVAKVDFCTVLPRFISLYIFSFLNPMDLCAAAQVNWPWKFLTEQDCLWRPKCIRFGWFL
PYDPSDNEYGAWKRHYIACVATLDWLTPREASAIYGTLNEPKSENEEQEERQRERHLRKI
IWEKLAFHRRELFKVRPPWMSGTCCSTVLKSRCQPQLPQVIKDRLKLSAALEKQLVLTSL
EALPKKKNIAGSQSYPLLSNKHYHRVDQKYGSFSHSVQTSLVLISSRIPAYERERESESI
ILGYIPSSVSWSSVKIIKYIMDLYIKKGSSSEMELWGLGLRSDGGDRKVNFFSGYTIGVE
NVLTPEVRDFWEKFGSCVATQEEGGHVDIFIPLAASEAGTKVLFQLSQLTGTRFSSPTGI
ATGSYQHILSEWLGQEQGTSPPSIYFCDHKLQTWYSFTEFLEETLKSVRKQLRPHFEELQ
RNISGKILGQFMFDSLSLANILTNQETAQVLADGLIELSKEKSERNLKDHSQEQKTGTSE
NDSKLEELINLERKLQMDLAEKRTRIAGELLKSERNYVQMLETVRDVYFTPLKAALASNR
AILSSTDIQIIFTDILCILDLNRYVLDTYYQNIDCAGPAQCFGEIFTKFGLQLKTYTNFF
NNYPIVLKTIEKLKQNVNRKNQLSDIERSVCGCPTLSEGNRFLIRVQNVAQLRYINEEIS
LSLRLYEHIYDLSLFLFNDALLVSRRTIVHTPFERTTETTYQFLALEVLHQLLIEDIPDS
KFIKNAFVLHGPKCQWICSTENEDKLVWLSVLQSTIRSSIEK
Download sequence
Identical sequences G3W1L8
ENSSHAP00000009323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]