SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009425 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009425
Domain Number 1 Region: 136-254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 240-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000503
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 15-70,108-162
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000105
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009425   Gene: ENSSHAG00000008154   Transcript: ENSSHAT00000009506
Sequence length 444
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834523.1:389885:519677:-1 gene:ENSSHAG00000008154 transcript:ENSSHAT00000009506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLKRILTVSILTLCLTSPGYAQQQCTNGFDLDRASGQCLDVDECRTIPDACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSGAYPPPPAPVPAPNYPTIARPVICRFGYQMDEGNQ
CVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANV
PGSYSCTCNPGFTLNEDGRSCQDVNECMTENPCVQSCLNTFGSFICRCDPGYELEDDGVH
CSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHQNHTCILQQT
CYNLQGGFKCIDPIRCEEPYLQISDNRCMCPAENPGCREQPFTILYRDMDVVSGRSVPAD
IFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPRDIQLDLEMIT
VNTVINFRGSSVIRLRIYVSQHPF
Download sequence
Identical sequences G3W1X0
ENSSHAP00000009425 ENSSHAP00000009425 XP_003756180.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]