SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009464 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009464
Domain Number 1 Region: 204-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000152
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 2 Region: 166-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000322
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 127-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000703
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 4 Region: 53-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000312
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 90-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 242-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000336
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009464   Gene: ENSSHAG00000008189   Transcript: ENSSHAT00000009547
Sequence length 270
Comment pep:novel scaffold:DEVIL7.0:GL856772.1:393297:418245:1 gene:ENSSHAG00000008189 transcript:ENSSHAT00000009547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKYFSFQSKNKTGCLSDPCLTNSTCDNVGKDNTCRCSGTTENMGEDCIKKLISCSSKPCK
RNGICFDLDTEPGFLCRCPPGYGGKTCEITFRSCVPGFCRHGGICHHGTSGPFCDCADGF
IGKHCETDFNECGSNPCRNGAVCQDGINGYSCYCVPGYQGRYCEREVDECVSEPCKNGAK
CHNRVGRYICECPPEFIGTNCESEIDECLSEPCLNGGICHDYVGHYFCECAFGFLGEHCE
VNTNDCISEPCLNNGQCIDGENRYVLICNG
Download sequence
Identical sequences G3W209
ENSSHAP00000009464 ENSSHAP00000009464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]