SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009509 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009509
Domain Number 1 Region: 495-634
Classification Level Classification E-value
Superfamily FAS1 domain 6.67e-27
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1696-1849
Classification Level Classification E-value
Superfamily FAS1 domain 9.94e-27
Family FAS1 domain 0.0063
Further Details:      
 
Domain Number 3 Region: 956-1105
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-24
Family FAS1 domain 0.0029
Further Details:      
 
Domain Number 4 Region: 361-485
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000000209
Family FAS1 domain 0.0074
Further Details:      
 
Domain Number 5 Region: 1537-1695
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000068
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 6 Region: 2120-2132,2273-2384
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000209
Family FAS1 domain 0.009
Further Details:      
 
Domain Number 7 Region: 2174-2237
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000235
Family Link domain 0.0073
Further Details:      
 
Domain Number 8 Region: 1110-1214
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000034
Family FAS1 domain 0.0068
Further Details:      
 
Domain Number 9 Region: 179-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000723
Family EGF-type module 0.053
Further Details:      
 
Domain Number 10 Region: 1432-1488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000227
Family EGF-like domain of nidogen-1 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009509   Gene: ENSSHAG00000008227   Transcript: ENSSHAT00000009592
Sequence length 2490
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841617.1:396559:445671:-1 gene:ENSSHAG00000008227 transcript:ENSSHAT00000009592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNFLQGIIHSKYCNMKTKFLTNSPCTSCVAFKNQACPVGWTKNWEKGPEDCSYSVTLGE
NTILMSGCSQVCWKEVEKKACCPGYWGSECYECPGGPNKPCNGHGTCLDGIGQNGTCVCE
EAYGGFACQDCKDGNSFGPDCKSVCACVHGVCKNGPQGDGSCVCFAGYTGPRCDQEVAAC
KDLACPQNSQCVNTDTGAPSCKCLPGYRLQGTKCQAQDPCSSCSPFATCSALENGNFECQ
CKAGYHGDGKFCQPVDPCTSNYGGCPSNSTRCLYLGPGKSICACKPGLTGISHNISEGCR
PIISSCRNFFCDSSATCQLDVQGRPRCTCKEGEIGDGRSCYGHFIRELERANSQHRFKRK
LSTALRMLENGCGEILSKSGPFTVLVPSLYVSRTLNESLSKSICKLYIIPGQHLMEERIT
APTYSRTWWTLAGESVTISGSKYLSPGKTMKYNDQLGSTYSIVQTNLPASNGVFHLISNI
RTLPPQSFIPGDPQKSIGKILASMDVFSRFETILENCGLPSILEGPGPFTVFAPSNTAVD
SMRDGRLIYLFTEGISKLQELVKHHIYSSAGLTVDKLITLRQIQTMANQVLLTNITDEGR
ILLGSPGIPLKTVDIVASNGIIHLLDGILLPPSILPILPHRCNENQYKIVLSTCGDCQAQ
NTSICPPDSQMLNIFPKECVYIHDPDGLNVMKKGCARYCNQTVVKLGCCKGFFGPDCSQC
PGGFSNPCYGKGKCSDGIQGNGACTCLKAYKGVACHICADPNRHGEQCEEAGATRKSKNG
NGGGSGSSQLQPPTPSPQRKENKKMGVMGNDGAQERSQVGNEHCRPRDTLKQGGFQPDTN
FQRETETETETERDRDRNRDKLRERDRERERQRERQRERQTQRKRLRERERERERERERE
DRDRERERERERQREREKTEREXGGPAALCPRLCLSSRWVFAPQATCRPRGDGAAPLCSC
PDGYGGDGFTCYGTILEELKRNDHFAEFYQWIKRAGFALPARGNFTALVPSEAAIRSLSP
KDKAFWLQQQQLLHLLRAHFLPDALTTRKLSDLFGQEVITLNPPTRWEISNSSGGITIQN
VSVAVADILATNGVLHILSKVLLPPRADVPPPRLSLRQQLDAVPSFSIFKELLLRYQLLS
QIEAAAKYTLFVPTNGSVEEYCLKANLSALDMETVKRHVLLGEALTPDALRPGMHRNSLL
GSSYELIFYMGKGGLEVRSVPLSPPQLGPGRICISFSGFITFSSLYLHLSLLFFCLVYVL
SSFRLYQKFLFEKGPRESCIYLSNGIRTIGCYYTCVKKKEIPDCCPGFFGTLCEPCPGGP
GGNCSGHGQCQDGLLGNGECRCHEGFHGTACEGCELGRYGPDCAGVCNCGHGMCQDGLLG
DGSCSCNVGWKGPRCDQENKDSLCPERCDPFANCINASCVCSAGYTGNGTSCSEVDPCAQ
NHGGCSLNANCTKVAPGQRTCTCKEGYSGDGELCLEVNSCLIKNGGCHARAECTPTGHGQ
VACNCGPGYAGDGIQSCDPDNPCAQDNGGCSRFASCNNTGPGQRTCTCGITTVGDGFTCR
TRISLELLRDKDAAFFSHYFMEYQELKGDGPFTVFVPREDLMRNFSRRKASPLPAQRRWR
SHTASTPLVFYSPPHPPSWGQPWGRDGGHPEPPAHGSYSSQGSVYINEYAQVVTEDQLGV
NGVLHFIDKLLLPPELVHWTNDSSPPPKQNITEAAQSWGYTIFSKLLTTARLLPMFHDKA
HQPFTVLWPSDEALRALPPERQAWLFHEDHRDKLAAILKGHVIRNVKALASDIPNLGELR
TMHGSPISFSCSKTLPGDLLVGEGEARIVQRHMEFLGGIAYGIDQLLEPVGLGSRCDHYV
KEQLSTFRQYCGSCVVLPLCPVGYKDEGEVEHCLRRPLFLRYTYYDSLSFSRKSPKFGCR
RRCFAVTWKPACCRGHYGIDCQVCPGGAENPCNGNGVCDDGLIGTGACRCNPGFNGTACE
LCAAGAFGPHCQACQCTEHGQCDDGISGSGFCFCGEGWTGQHCETKLGGADVQPVCSPPC
DRHAVCREDNVCECNLDYEGDGHKCTLIDHCQNGHGGCSQHANCSQQGVLVTCTCHPDYE
GDGVFCRARDRCADGQNGGCSEHAECISTGPNTRRCECRAGYVGSGVQCLVEAVPPEDRC
LESPGPCHPEAICTDLHFQEKRAGVFHLQSREGKYRLSFREDREQCAAQGAVLASFEQLS
AAQQVKKPAGAAGGLGGNLEAGSLCKAGRRRGGADLAASFPQLLLDYANTSQPGLEFLGF
LSDELTSKTLFVPLNSGFGDNVTLSWKDLELHASNVTFLSLNLSQSAVLPAHSGHQLFIS
NDSAGNRTGFKGGFDMVRVSAIVEWDIIAFNGIIHAIQSPLTVPPEPEAPMARSTTSVAV
GLSTALGTGLVLGLVALYFHHKVKGQGFQFHYFKAEDDEDDFSPWQEGPSPPLISVPNPT
FDGCDSFYEPFDDSLLEKEFSDTHRILEED
Download sequence
Identical sequences G3W254
ENSSHAP00000009509 ENSSHAP00000009509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]