SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009513 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009513
Domain Number 1 Region: 1009-1221
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-52
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 1690-1928
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000047
Family WD40-repeat 0.015
Further Details:      
 
Domain Number 3 Region: 1218-1311
Classification Level Classification E-value
Superfamily PH domain-like 0.000000246
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009513   Gene: ENSSHAG00000008231   Transcript: ENSSHAT00000009596
Sequence length 2011
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849730.1:397053:540427:-1 gene:ENSSHAG00000008231 transcript:ENSSHAT00000009596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGPPPPPLYRSISFKRLERWSGGPGCDRADCAEETPSSSPGLRRRAPGTTTLAAFPPL
SQVGSGGSRDLPEVLPWPGAGVGGGGPGSEPTGHWPSVTEMRKLFGGQSFRRPSPDGLWS
SSPASASPTRDDGAQSPEEPPGRQQPPPPPPRTCFPLSGLRSPLPRAQAEGRRQQQADSS
HSWHSYCQPHAGPQASVCSSSSSPATAFYPVSRSLSRGESSSEEEEQAGAPGICAAPSPG
AQPSGGSGSEGDGLKEEGILQASSYRKEASAGGWDLDNDGLKPGRMDSPEQIPEDQGLNS
QGPGCGTEGLQSARGSQEGLRQLSRGLPESFGSTFPMVSRVAKVSFPPYVASLGRHSSTE
KLREEDLWTGRGSWGLYRSPSFGTGDGFLRPQAHARPKPLVCTGKGQRDRPNEAVEPSYK
AMELEKSRQRKSLSNPDIASETLTLLSFLRSDLSELKVRRSGRRPGDQDGTPQSCGDATE
DTELTGHQGSLLAPGRQALGTRPTLKDLTATLRRAKSFSCSEGPSPRRLSRTGALKPSSS
ELLLARRRAEEEEEEEGLPEVVQDQYVQEAQQVFEKISQMGARRDEGGSPPALHLPTSSP
CRRSLEELSGHESSLTDEGIVTEPEPASIAYRGLGPLSEWKSGEFPLSSSRMNPSGPPAE
GGWASPTGPLDAPGTPGALRRRRKAPPLGPGGTDLSNGDASEAYRSLSDPMPHHRRPTPL
EESSGFSVDSNLLGSLGPKAGLPPASAVALADCGAAGASDSSIGSDGGKDFQEVIQSVVH
QPGALGRAVDERVHGRAAKKKSLSDPSRRGEQASPGFEGPGGEPILEAALPPASSEPILL
EHQSDEPGKTRAQSERVLPKTLSATAPLDFHLDPKLADVLSPRLARRSSKKRPARSSHQE
LRKEEDTAPLGRAQPGSRHVRHASEPAAFIPIEAPEPIATGTETSGSPALQVPSLEDVTK
QYMLTLRTSEAPAGGPTDVSQSTPATPTSSEAKPPEAARPPEEPIPTERRQSQSKPQVDM
RKHVIMTLLDTEQSYVESLRTLMQGYMQPLKQPENAVLCDPSLVDEIFNQIPELLEHHEQ
FLEQVQNRVQEWHTRQKVGDLLVQSFSKDILVNIYSAYIDNFLNAKDAVRIAKEARPAFL
KFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEEHPDRPFLIDAHRNIKQ
VAEKINKGMKNAEEVERHARVLLEIEAHIEGMEDLQAPLRRFLRQEMVVEVKAVGGKKDR
SLFLFSDLLVCTTLKRKSGSLRRSSMSLYTAASVIDIASKYKLLWKLPLEDADIIKGASH
ATNRESVQKAISHLDEDLNTLGQISKLSESLSFPHQSLDDVIKELTAAAHRDLAEKQALC
YTLSFPPNKVELSATRPEGTDTFIFEFPHPDARVGFEQAFDEAKRKLASSKNCLDPEFLK
AIPIMKTRSGMQFSCASPSHSTCAESAHEVWVCNSDGYVGQVCLLSLRAEPTVEACIAVC
SARILCMGSVPGLQPPPAPQISGPKPKDQPPSLVSPACPPEVVTTAAALEEGSSQPCLHI
SISGSSPELPPGPANSTPGPELMPFDSDDSDDESSPSPSGTLQSQASRSTISSSFGNEEM
PSSKEATAETTSSEEEPEPGFLPLSSSFGPSGPHGGSPVDGRALRRSSRGSFTRGSLEDL
LSMDPEAYQSSMWLGTEDGCIHVYQSSDSIRNRKNSMKLQHTAAVTAIMYLDNQVFVSLA
NGELVVYNREAGHFWDPQNSKSLVLGSPGNPVTKMVSVSGKLWCGCQNRIFVLNTGSLQQ
EHTFQVGLDPNRSVACMVNSSLGVWIALHSTAQVRLYHSGTFEQLAEVDITPPVHKMLAG
SDAIIRQHKAACLRITALLACEDLLWIGTSAGVVLTMPTSPNTVSTPRAPLSPAGLVQGH
TGHVRFLTAIELPDNFDLLCPPPSHDASPEKPPLLERRDSSRHRGSAPAPAKPKMLVISG
GDGYEDFRLSGSSSETVGRDDSTNHLLLWRV
Download sequence
Identical sequences G3W258
ENSSHAP00000009513 ENSSHAP00000009513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]