SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009530 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009530
Domain Number 1 Region: 76-296
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-54
Family DBL homology domain (DH-domain) 0.000087
Further Details:      
 
Domain Number 2 Region: 420-505
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 287-425
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-17
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009530   Gene: ENSSHAG00000008245   Transcript: ENSSHAT00000009613
Sequence length 540
Comment pep:known_by_projection scaffold:DEVIL7.0:GL857009.1:398099:448621:1 gene:ENSSHAG00000008245 transcript:ENSSHAT00000009613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLYQEYRDKSTLHEIETRRLQDAEVQVDTDKSPDSEETPPEEEPASSPDSSPEKKPLPQ
ICLLNNANSRFNLWQDLPEIRSSGVLDILQPDEIRLQEAMFELVTSEASYYKSLSLLVSH
FMDNERLKKILHPSESHILFSNVLDVMAVSERFLLELEQRMEENIVISDVCDIVYQHAAN
HFSVYITYVSNQTYQERAYKQLLQEKAAFREVISQLELDPKCKGLPFSSFLILPFQRITR
LKLLVQNILKRVEESSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKI
KSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFQEIYLFLFNDLLVICLFPDLPPSP
PPRDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKR
WMTSLAPNRRTKFVSFTSRLLADCPQVQCVHPYVAQQPDELSLELADILNILEKTEDGWI
FGERLHDQERGWFPSSMVEEIMNPKIRSQNLKECFRVHKMDDTQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences G3W275
ENSSHAP00000009530 ENSSHAP00000009530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]