SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009571 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009571
Domain Number 1 Region: 145-478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-86
Family Protein kinases, catalytic subunit 0.0000000000133
Further Details:      
 
Domain Number 2 Region: 1-142
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.51e-38
Family Regulator of G-protein signaling, RGS 0.000000643
Further Details:      
 
Domain Number 3 Region: 512-620
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-23
Family Pleckstrin-homology domain (PH domain) 0.00000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009571   Gene: ENSSHAG00000008279   Transcript: ENSSHAT00000009654
Sequence length 646
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841447.1:401873:541078:1 gene:ENSSHAG00000008279 transcript:ENSSHAT00000009654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKYLNERGELTFDKIFNQKIGFLLFKDFCLNEIDEAVPQVKFYEEIKEYEKLDSEEERL
RRSRQIYDTFIMKELLSSSHVFSKQAVDHVQTHLAKKKVPSNLFQPYIEEICDSLRGNIF
QKYIESDKFTRYCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
DKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYH
LSQHGVFSEKEMKFYAAEIILGLEHMHNRFVVYRDLKPANILLDEYGHVRISDLGLACDF
SKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEI
DRMTLTVNVELPDAFSPELKSLLEGLLQRDVSQRLGCLGNGAEEVKSHIFFKGVDWQHVY
LQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVA
ETVYEAVNADTDKMEARKRAKNKQLGHEEDYALGKDCTLHGYMLKLGNPFLTQWQRRYFY
LFPNRLEWRGEGESRQNLVTMDQIVSVEETQIKDKKCILLRIKGGKQLVLQCESDPEYVQ
WKKELIETFTEAQRLLRRAPKFLNKPRPTVVELSKPPLSHRNSNGL
Download sequence
Identical sequences G3W2B6
ENSSHAP00000009571 ENSSHAP00000009571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]