SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009729 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009729
Domain Number 1 Region: 572-761
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.95e-56
Family Nucleotide and nucleoside kinases 0.00000000968
Further Details:      
 
Domain Number 2 Region: 343-440
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-33
Family PDZ domain 0.0000191
Further Details:      
 
Domain Number 3 Region: 444-600
Classification Level Classification E-value
Superfamily SH3-domain 1.3e-31
Family SH3-domain 0.00000498
Further Details:      
 
Domain Number 4 Region: 90-193
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-28
Family PDZ domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 197-291
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-26
Family PDZ domain 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009729   Gene: ENSSHAG00000008419   Transcript: ENSSHAT00000009814
Sequence length 764
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856862.1:420006:445601:1 gene:ENSSHAG00000008419 transcript:ENSSHAT00000009814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKKPGVPRSALWLLAPPLLQWAPYLLAVLHSDLFQALLDILDYYEDAVCDSLKYRYQDE
DTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYVNGTEGEMEYEEITLERGNSGLGFSIA
GGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEA
GSIVRLYVMRRKPPAEKLMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAA
HKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNTYLSDSYAPPDI
TTSYSQHLDNEISHSSYLGTDYPPAMTPTSPRRYSPVAKELLGEEDIPREPRRIVIHRGS
TGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNATHEQAAIALK
NAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYD
KTKDCGFLSQALSFHFGDVLHVIDAGDEEWWQARRVQPDGETDDIGFIPSKRRVERREWS
RLKAKDWGSSSGSQGREDTVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFG
SCVPHTTRPKREYEVDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVA
EQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENILEINKRITEDQARKAFDRATKL
EQEFTECFSAIVEGETFEEIYHKVKRIIEELSGPYIWVPARERL
Download sequence
Identical sequences G3W2S4
ENSSHAP00000009729 ENSSHAP00000009729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]