SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009740 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009740
Domain Number 1 Region: 95-230
Classification Level Classification E-value
Superfamily SET domain 9.27e-37
Family Histone lysine methyltransferases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009740   Gene: ENSSHAG00000008429   Transcript: ENSSHAT00000009825
Sequence length 239
Comment pep:novel scaffold:DEVIL7.0:GL867574.1:421115:421831:1 gene:ENSSHAG00000008429 transcript:ENSSHAT00000009825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQMVAQYQIMTRSRVRAALREAEASTSSQAMGAAFTRSRSRETLSVQGRKKPRSRKRILK
AKHPSQNYRVTDYFPIRRSTRKNRGELRSEERIRLNALIQSGKEEGMRVGLFEGKGRGVI
TTKPFQRGDYVVEYHGDLIDLALAKKREARYAKDPDTGCYMYYFHYRSKGYCVDATKESG
RLGRLINHSKSGNCQTKLHPINGVPHLIVIATRDIAVGEELLYDYGDRSKASLEAYPWL
Download sequence
Identical sequences G3W2T5
ENSSHAP00000009740 ENSSHAP00000009740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]