SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009791 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009791
Domain Number 1 Region: 36-109
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000035
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009791   Gene: ENSSHAG00000008474   Transcript: ENSSHAT00000009877
Sequence length 234
Comment pep:novel scaffold:DEVIL7.0:GL841318.1:426770:435510:-1 gene:ENSSHAG00000008474 transcript:ENSSHAT00000009877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGVAGAMYYLCERAFTSRWKSAKEEFCYPVECLALTVEEVMHIRQVLVKAELEKYQQYK
DVYTALKKGKLCFCCRTRRFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLG
PSALQRGESFMRPEKPSASHHRPLRSIARFSSKSKSVDKSDEELQFPKELMEDWSTMEVC
VDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSAGPSEYCPSERTINEI
Download sequence
Identical sequences G3W2Y6
ENSSHAP00000009791 ENSSHAP00000009791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]