SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009819 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009819
Domain Number 1 Region: 2-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009819   Gene: ENSSHAG00000008501   Transcript: ENSSHAT00000009906
Sequence length 40
Comment pep:novel scaffold:DEVIL7.0:GL849614.1:430316:430435:-1 gene:ENSSHAG00000008501 transcript:ENSSHAT00000009906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESLDT
Download sequence
Identical sequences G3W314
ENSSHAP00000009819 ENSSHAP00000009819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]