SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009996 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009996
Domain Number 1 Region: 348-493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-28
Family MAM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 7-154
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000549
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 3 Region: 166-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000368
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009996   Gene: ENSSHAG00000008649   Transcript: ENSSHAT00000010084
Sequence length 502
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849810.1:446449:489156:-1 gene:ENSSHAG00000008649 transcript:ENSSHAT00000010084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTQKPVCYSVCDHGCKYGECIGPNKCKCFPGFTGKTCNQDMNECGLKPRPCKHRCMNTHG
SYKCYCLSGYMLMPDGTCSNSRTCAMTNCQYGCEGMKDEVRCLCPSAGLQLGPNGRACID
IDECSSGKVLCPYNRRCVNTFGSYYCKCHIGFELKYISGRYDCVVDINECSANTHKCSIH
ADCLNTQGAFKCKCRQGYKGNGLHCSAIPENSVKEIFRAPGTIKDSIKKLLAHKNSVKKN
EEIKNVIPEPAVTPSIKVLLQPFHYEDSIQTGGAYDEKVKEHENTKREERMEEEEGQIDL
KNQIDPEKSLRGDVFFSKVNEAVPFDLFPIQRKVLTSKLEHKVDLNSSIDCNFDQGICDW
IQDTDDDFDWNPADRDNAVGYYMVVPAFVGHKNNVGRLILLLSNLQPQSSSCLMFNYRLA
GERVGTLRVFVKDKNNTLAWEETSSEDGRWRTEKIQLYHEIETTKSVIFEAERGKGKTGE
IGLDTVLLVSGICPESFLSISF
Download sequence
Identical sequences G3W3J1
ENSSHAP00000009996 ENSSHAP00000009996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]