SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010248 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010248
Domain Number 1 Region: 151-346
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.37e-59
Family Astacin 0.0000753
Further Details:      
 
Domain Number 2 Region: 773-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-38
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 353-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-37
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 4 Region: 467-571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 618-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-35
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 6 Region: 909-1002
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-26
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 7 Region: 729-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000479
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 574-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000373
Family EGF-type module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010248   Gene: ENSSHAG00000008850   Transcript: ENSSHAT00000010338
Sequence length 1013
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864805.1:472595:763505:-1 gene:ENSSHAG00000008850 transcript:ENSSHAT00000010338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMEMLSQKMVLWLMASGLIFSGEMWISSGFDYDYTYAFHEEDKTETLDYKDPCKAAVFW
GDIALDDEDLRNFPIDRTIDLTQNSFEKLGHITGGLGNHGVSKKRGVLYQLIDRIRRFGS
GLEQNNTAKARASVKFSGQNEKNRVPRAATSRTERIWPGGVIPYLIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDKHVTIIRENIQPGQEYNFLKMEPGEVNSLGESYDFDSIMHYA
RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESTGNF
SSPGFPNGYPSYTHCIWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIHKNEGQIQSPNYPD
DYRPMKECVWKIIASENYNVGLTFQAFEIERHDSCAYDYLEIRDGSSENSPLIGHFCGYD
KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDNGGCEQRCVNTLGSYQCA
CEPGYELGPDKRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCIWQVVAPTQYRISMKF
EFFELEGNEVCKYDFVEIRSGLSSDSKLHGKFCGTEVPEVITSQFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECINTVGSYVCQCRNGFVLHENKHDCKEAECEQRIHS
PSGVITSPNWPDKYPSRKECTWEISATPGHRVKLAFSEFEIEQHQECAYDHLEVFDGETE
KSPILGRLCGNKMPDPLIATGNKMFLRFVSDASVQRKGFQARHSTECGGRLKAESNPRDL
YSHAQFGDNNYPVQVRCEWLLISERGSSVELSFQTFEVEEEADCGYDYVQLFDGHDSTAR
NLGRFCGSGPPEEIYSSGDAILIYFHTDDTINKKGFHIRYKSRKYSATTHTKK
Download sequence
Identical sequences G3W493
ENSSHAP00000010248 XP_003773139.1.9362 ENSSHAP00000010248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]