SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010343 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010343
Domain Number 1 Region: 146-173,211-451
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.69e-84
Family Eukaryotic proteases 0.000000186
Further Details:      
 
Domain Number 2 Region: 41-103
Classification Level Classification E-value
Superfamily GLA-domain 4.91e-25
Family GLA-domain 0.00011
Further Details:      
 
Domain Number 3 Region: 92-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000914
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010343   Gene: ENSSHAG00000008930   Transcript: ENSSHAT00000010433
Sequence length 453
Comment pep:known_by_projection scaffold:DEVIL7.0:GL867602.1:482482:526483:1 gene:ENSSHAG00000008930 transcript:ENSSHAT00000010433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLPLLLIICCSGYFFGAEGTVFLDHKNATKLLSRPKRYNSGKLEEFIQGNLERECNEE
KCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGICKDEINSYECWCRKGYEGKN
CELDADCSIKNGGCKQFCKMNELNKVVCSCISGYQLGEDQKSCEPAVPYPCGRVSLPVTK
LTRAETFFSDMDTANSTEEEEVPDAVTQIVPFHKEDTRIVGGEDARKGQIPWQVILNGKV
KGFCGGSIINEKWVITAAHCIEPDNEITVVAGEHDTETKEGTEQTRRVIRVIPHHTYNAS
KNMYSNDIALLELEEPLKLNEYVTPICVADRKYTNLFLKLAKGTVSGWGKVFHKGRPASI
LQFLRVPFVDRATCLRSTTVTIENNMFCAGYSQGGKDSCQGDSGGPHTIEVEGTSFLTGI
ISWGERCAVKGKYGIYTKVSSFVKWIKEKTKYT
Download sequence
Identical sequences G3W4I8
ENSSHAP00000010343 XP_003774908.1.9362 ENSSHAP00000010343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]