SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010363 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010363
Domain Number 1 Region: 42-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 162-351
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000017
Family Pentraxin (pentaxin) 0.0051
Further Details:      
 
Domain Number 3 Region: 835-1120
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000156
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010363   Gene: ENSSHAG00000008948   Transcript: ENSSHAT00000010454
Sequence length 1175
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856959.1:484896:568787:1 gene:ENSSHAG00000008948 transcript:ENSSHAT00000010454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKNRVGRKRRDGRVKSSNMVFLSISSHLFLCFPLSFVWGCANCRVTLSSPSGTFTSPCYP
NEYPNSQVCMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGL
SFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVIIPQATDANRVSVAKTVSIP
ELSAFTVCFEATKIGNEDNDWIAFSYSDALSTQLLSFGKAKRGYFLSISGVECLLNKVLL
VDSNEDIFTENFEQLCLSWNSSLGSVSVNFKRSYETVICNSTISKVIPGNGKLLLGSNQN
EIASLKGDIYNFRLWNFTMNSKTLSNLSCNVKGNVVDWQNDFWNIPTSVLKAENNLSCGS
YLIPLPASELTSCAELGTLCQGTDGIIYRISIIIQNILRQPEVKVQSKVAEWISWTFKTY
SHSAYIYIYIYIYIYIXEGEKEEVTDLIHEVGGRYKSSILFYDNTTHTLSFKDGRLIRTL
FLLNEFVQMNLIVVFFLYTGTCPENEQPEGYKWSTTKPAVQTYPCKGKPGYFASRTCLQD
TTNKTFWGPPDLTNCAGITNEIANELLNFTSEGQTLTSANITSIVEYLKKIVNNEENIDI
SLGSTVMTIFSNILTSSDNELLESSSEALKTIDELAFKIKLNNEVPVNITTRNLALGVSS
LIPETYEGSTFSIGLPNSNDSYFQMDFETGQVNSLASVILPRSLLMNLSKEESESVKRAQ
FTFFNKTGLFQDVETQRDKLVSYVMACSIGNISIRDLQEPIQVIIKHTRNQEVLHPICVF
WDLNKNKGFGGWNTSGCVAHRDSNENETVCLCNHLTHFGVLMDLQGTASQIDARNTKVLT
FITYIGCGVSAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLFLNLIFLLDGWVTSFD
IDGLCVAIAALLHFFLLATFTWMGLEAVHMYIALVKVFNTYIRRYILKFCIIGWGLPALV
VTIVLASRNTNANKIYGKEGYGQDIKGQRSEFCWIQDPVVFYVTCAGYFGVMFLLNVAMF
IVVMVQICGRNGKRSNRTLREEILRNLRSVVSLTFLLGMTWGFVFFAWGPLNIAFMYLFS
IFNSLQGLFIFVFHCAMKENVQKQWRRHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKS
LSSSSIGSNSTYLTSKSKSNSTTYFKRNSHPVSFA
Download sequence
Identical sequences G3W4K8
ENSSHAP00000010363 ENSSHAP00000010363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]