SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010384 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010384
Domain Number 1 Region: 190-316
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.03e-29
Family Synaptotagmin-like (S variant) 0.0000025
Further Details:      
 
Domain Number 2 Region: 934-1053
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.08e-24
Family Synaptotagmin-like (S variant) 0.0088
Further Details:      
 
Domain Number 3 Region: 19-146
Classification Level Classification E-value
Superfamily PDZ domain-like 1.73e-16
Family PDZ domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010384   Gene: ENSSHAG00000008965   Transcript: ENSSHAT00000010477
Sequence length 1082
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856907.1:487237:721585:1 gene:ENSSHAG00000008965 transcript:ENSSHAT00000010477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDLDYYWLDPTTWPSRETSPISSHPVTWQPSKEGDRLIGRVILNKRTTMPKESGALLGLK
VVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAVQGDEVLEWNGKPLPGATNEEVYNIIL
ESKSEPQVEIIVSRPIGDIPRIPESSHPPLESRIQKVMVVLETNEFLLITIYGPFSPYLL
QHRPQGLTVFLTVKLWYDKVGHQLIVNVLQARELPPRVDGRPRNPYVKMYFLPDRSDKSK
RRTKTVKKVLEPKWNQTFLYSHVHRRDFRERMLEITVWDQPRVQEEESEFLGEILIELET
ALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQRSQRIIDSDISDYEVD
DGIGVVPPVGYRSNTRESKSTTLTVPEQQRTAHHRSRSVSPHRGDDQGRPRSRLPNVPLQ
RSLDEIHQVRRSRSPTRHHDASRSPVDLRSRDVDSQYLSEQESELLMLPRAKRGRSAECL
HTTSELQPSLDRARSASTNCLRPDTSLHSPERESPIHWTNRGRCSPSLDRRRPTSPRIQI
QHASPEDDRQSRKSERSSNQKQTRKSNASDAERVLPQHLSRRGHPTPRTTDQPVIRGKHP
SRSRSSEHSSVRTLCSIHHLAPGGSAPASPLLTRIHQQGSPGQSPPADTTFSNRRGRQLP
QVPIRSGSIEQASLVVEERTRQMKMKVHRYKQTTGSGSSQELDREQYSKYNIHKDQYRSC
DNVSAKSSDSDVSDVSAISRTSSASRLSSTSFMSEQSERPRGRIRYSSFTPKMQGRRMGT
SGRTITKSTSVSGEMYKLEHNDGSQSDTAVGTVGTGGKKRRSSLSAKVVAIVSRRSRSTS
QLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRL
GADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSK
STPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRM
DHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSLESSTGPPCI
RS
Download sequence
Identical sequences G3W4M9
ENSSHAP00000010384 ENSSHAP00000010384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]