SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010424 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010424
Domain Number 1 Region: 97-163
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000153
Family Ovomucoid domain III-like 0.00017
Further Details:      
 
Domain Number 2 Region: 190-238
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000984
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Domain Number 3 Region: 261-315
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000222
Family Ovomucoid domain III-like 0.0081
Further Details:      
 
Domain Number 4 Region: 26-64
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000165
Family TB module/8-cys domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010424   Gene: ENSSHAG00000008999   Transcript: ENSSHAT00000010517
Sequence length 343
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841158.1:491872:500366:1 gene:ENSSHAG00000008999 transcript:ENSSHAT00000010517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNLRNQPGMLLLLILLCQLMEDRTVQAGNCWLRQAKNGRCQVLYKTNLSKEECCSTGRL
STSWTAEDVNDNTLFKWMIFNGGAPNCIPCKETCDNVDCGPGKKCKMNKKNKPRCVCAPD
CSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVLCPGSSTCVV
DQTNNAYCVTCNRICPEPTSSEQYLCGNDGITYPSACHLRKATCLLGRSIGLAYEGKCIK
AKSCEDIHCSSGKKCLWDFKIGRGRCSLCDELCPESKSDEAVCASDNATYASECAMKEAA
CSTGVVLEVKHSGSCNSITEDTEEEEEDEDQDYSFPISSILEW
Download sequence
Identical sequences G3W4R9
ENSSHAP00000010424 XP_003759404.1.9362 ENSSHAP00000010424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]