SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010473 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010473
Domain Number 1 Region: 85-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000177
Family EGF-type module 0.009
Further Details:      
 
Domain Number 2 Region: 55-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000297
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 129-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000612
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 5-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000021
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010473   Gene: ENSSHAG00000009040   Transcript: ENSSHAT00000010566
Sequence length 281
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834588.1:496983:518501:-1 gene:ENSSHAG00000009040 transcript:ENSSHAT00000010566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNISLDLQLCAAKSCHKNGTCTGSEESGSRCSCAPGSSGRNCRFKEGPCVINGSPCQNG
GACIDENGLASYTSCLCPEGFSGNFCELDMNSCVPNPCENGGVCTDIGGDFRCRCPLGFM
DKTCSQHVVDHCASGPCEHGGTCVPHARGGFECLCRPEFSGPTCNHGHPNHSHPGTKTKR
GPGLPDQFSPETQGRLAAHQPNHRMLKITMRELTKNSKPLLNESQAICFTILGVLTCLVV
LGTISIVFFNKCEIWLSNAKYSRLLRKKKNSLLRSPIKMSG
Download sequence
Identical sequences G3W4W8
ENSSHAP00000010473 ENSSHAP00000010473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]