SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010496 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010496
Domain Number 1 Region: 385-735
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-86
Family Protein kinases, catalytic subunit 0.00000156
Further Details:      
 
Domain Number 2 Region: 204-304
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 3.4e-44
Family MAST3 pre-PK domain-like 0.00000677
Further Details:      
 
Domain Number 3 Region: 965-1056
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-18
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010496   Gene: ENSSHAG00000009059   Transcript: ENSSHAT00000010589
Sequence length 1360
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841419.1:498622:560494:1 gene:ENSSHAG00000009059 transcript:ENSSHAT00000010589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSRRDKLNIPALTLDLSPSSQSPTLLSPCSPASPCSPLQTLHPWSCRSGNRKSLVVGTP
SPTLSRPLSPLSVPTAGSSPLDSPRNFSASTAVNFPFARRADGRRWSLASLPSSGYGTNT
PSSTVSSSSSSRERLHQLPYQPTPDELHFLSKHFRSSESIVDEDGGRRSPCMRPRSRSLS
PGRTTGAFDSDIVMMNHVYKERFPKATAQMEERLQDIITTFCPSNTLALADGVLSFIHHQ
IVELARDCLAKAREDLVTSRYFLELQEKLEKMLQDAHERSESQEVTFIGQLVRKLLIVIS
RPARLLECLEFDPEEFYHLLEAAEGHARVGQGIKTDIPRYIIGQLGLTKDPLVEMVQLGP
QDADAGDPPENRSLTVPSRRKPCESDFETIKLISNGAYGAVYLVRHRETRQRFAIKKINK
QNLVLRNQIQQVFVERDILTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMG
PLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKIGLMSMT
TNLYEGHIEKDAREFVDKQVCGTPEYIAPEVIFRQGYGKPVDWWAMGVILYEFLVGCVPF
FGDTPEELFGQVISDDIIWPDGDEALPADAQDLITKLLKQSPLDRLGTGGAFEVKQHPFF
HNLDWTGLLRQKAEFIPQLEAEDDTSYFDTRSERYRHLGSEDDETNDEESSTEIPQFSSC
SHRFSKVYSSSEFLAVQSNLTFSERSYSEDKEERSERWERGSGEEEKSRPLSTEVRLRSW
TSSGSLRHSSSSSSQPERSQSPSALSTTYSLDPMPKFAFSSEDEASSQGPSQPQRPIFVL
GEPEEPVKETTKASALTADGSSLSHIRLRSNSTGAKNSTPRGLEGGTSRRLGGQKETPEK
QKTSPVGGRVPKSASVSALSLVITSDDCSSGALMSPISPHSLSSNPSSRDSSPSRDSSIG
ITNLRPPIIIHSSGKKFGFSLRAIRVYMGDSDVYTVHHVVWSVEEGSPAHEAGLRAGDLI
THINGESVLGLVHMDVVELLLKSNNKISLRTTALENTSIKVGPARKHSNKGRMARRSKKS
RKRESQDRRKSLFKKISKQSTMLHTSRSFSSGLHHSLSSSESLPGSPTHSLSPGPTTPCR
SPAPDAPPDTASPQSTSPSSSTPTSPAGHIRPSSLHGLASKLGAPRYKVGRRKSTSSIPP
SPLACTPSPGPQPPSPQRSPSPLPGYPKNLYAFQGKTLSPPMITRQTSRPRSAETPRSPL
LKRGQSADKIAPSLVEKKPLGGRKLTLEMPAGDRDGLEEASGHTGSASRGRDWAGDRHER
DQEVVVMRRLNLSERRDSFKKQXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences G3W4Z1
ENSSHAP00000010496 ENSSHAP00000010496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]