SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010919 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010919
Domain Number 1 Region: 401-665
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-54
Family YWTD domain 0.000000000696
Further Details:      
 
Domain Number 2 Region: 146-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.00029
Further Details:      
 
Domain Number 3 Region: 198-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000011
Family LDL receptor-like module 0.00031
Further Details:      
 
Domain Number 4 Region: 108-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000128
Family LDL receptor-like module 0.00025
Further Details:      
 
Domain Number 5 Region: 30-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00032
Further Details:      
 
Domain Number 6 Region: 66-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00032
Further Details:      
 
Domain Number 7 Region: 234-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 8 Region: 287-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 9 Region: 667-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000907
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010919   Gene: ENSSHAG00000009412   Transcript: ENSSHAT00000011013
Sequence length 865
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841402.1:541579:575091:-1 gene:ENSSHAG00000009412 transcript:ENSSHAT00000011013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAPRALDVLLSSGLFVILILPTATNAVDKCGRNEFQCLDGKCISYKWVCDGTAECKDGS
DETLETCSSVTCKQGEFSCGGRINRCIPSTWKCDSHNDCENGSDEQDCPPKTCAHDQFRC
HDGKCISQEFVCDTDRDCEDGSDELNCPDPTCNPATFQCNNTVCIPKLWACDGDQDCEDG
SDEWPDNCGGHSLVKESKPCSSLEFHCGSGECIHMSWKCDGGFDCKDKSDEEGCVKATCR
PDEFQCNDGECVHGSRQCNKEYDCKDMSDEMGCVNVTLCEGPDKFKCHSGECISFDKVCN
GPRDCRDWSDEPIKECGTNECLDNKGGCSHICNDLKIGYECLCPEGFRLVDQKRCEDIDE
CQNPDICSQSCVNLQGSYKCECNEGYQTDPITKTCKAIGTIAYLFFTNRHEVRKMTLDRS
EYISLIPNLKNVVALDMEVASNKIYWSDLSQKKIYSSEIDSAHSFSTHDTVISGDIQAPD
GIAVDWIHGNLYWTDSVLGTISVANTKGSKRKTLFKQEGAKPRAIVVDPVHGFMYWTDWG
TPAKIEKSGLNGVDSFPLVTENIQWPNGITLDLSSERLYWVDSKLHSISSVDVNGGNRRI
VLEDKNKLAHPFSLAIFEDKVFWTDIMNEAIFSANRLTGSDIILVAEDLLSPEDIVLYHN
LTQPTGVNWCERTSLPNGGCQYLCLPAPQINSHSPKFTCACPDGMSLAADMRKCTKEVTV
PATSTTAKAPHSKLTTLARLVTPVTTRKPTTKNGTPDLTTAEMVTMSQKAVQNPMGMQDT
PEHQGGSKALYIVLPLVLISLICFGAYVVWKKWRLRNINSINFDNPVYQKTTEDEVHICR
SQDGYTYPSVIGLFVHSVTLLINIH
Download sequence
Identical sequences G3W664
ENSSHAP00000010919 ENSSHAP00000010919 XP_012397332.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]