SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011110 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011110
Domain Number 1 Region: 777-884
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-22
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 250-371
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 588-704
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000432
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 212-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000502
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 132-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 173-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011110   Gene: ENSSHAG00000009564   Transcript: ENSSHAT00000011204
Sequence length 961
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856879.1:559126:581614:1 gene:ENSSHAG00000009564 transcript:ENSSHAT00000011204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYSGDGKHCKDVDECERDDNAGCVHECVN
IPGNYRCTCYDGFHLAHDGHNCLDLDECAEGNGGCQQSCVNMMGSYECLCRDGFFLSDNQ
HTCIQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGC
QHTCDDTEQGPKCGCHVKFVLHTDGKTCIETCAVNNGGCDSKCHDAATGVHCSCPVGFML
QPDRKTCKDIDECRLNNGGCDHICRNTVGSFECSCKKGYKLLINERSCQDIDECSFDRTC
DHICVNTPGSFQCFCHRGYLLYGLTHCGDVDECSVHRGGCRFGCINTPGSYQCTCPTGQG
RLHWNGKDCTELVKCQGSPGAPRAMLSCSRSGKKDTCALTCPSRARFLPESENGFMVSCG
TPSLRSSQSRIGNHTSAHHCLETAALSVKQRASFKIKDAKCRLHLRNKGKLEEAGKVAAS
GGTPCSDCHVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVKAEETTASCGLPC
LRQRMERRLKGSLKMLKKSINQDRFLLRLAGLDYELAHKAGSAGERAEQAETCVPGQHRS
GVKCVSCPQGTYYHGQTEQCVPCPPGTFQEREGQLSCDLCPGSDAHGPLGATNITTCAGQ
CPPGQFSADGFKPCQQCPRGTYQPESGRTLCFPCGGGLTTKHEGAVSFQDCDTKVQCSPG
HYYNTSIHRCIRCALGSYQPEFRQNFCTRCPGNTSTDFDGSTSVTQCKNRQCGGEIGEFT
GYIESPNYPGNYPAGVECTWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSI
TTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGR
LYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPRSFIKLLRSKVSSFLRPY
K
Download sequence
Identical sequences G3W6Q5
ENSSHAP00000011110 ENSSHAP00000011110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]