SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011352 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011352
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.07e-60
Family BAR domain 0.000000237
Further Details:      
 
Domain Number 2 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 4.03e-23
Family Pleckstrin-homology domain (PH domain) 0.0000144
Further Details:      
 
Domain Number 3 Region: 471-614
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-21
Family Phosphotyrosine-binding domain (PTB) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011352   Gene: ENSSHAG00000009765   Transcript: ENSSHAT00000011448
Sequence length 662
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861604.1:585749:665060:-1 gene:ENSSHAG00000009765 transcript:ENSSHAT00000011448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSKQLLAYEKQNFALGKGDEEVITTLHYFSKVVDELNLLHTELTKQLADSMVLPIIQFRE
KDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKSEVAKEVAAARRKQHLSSLQ
YYCALNALQYRKRIAMMEPMLGYAQGQINFFKKGAEMFSKRMDTFLSTTKAMVQSIQEES
EAEVEKMRLAQQELLSVDESVYTPDFDVAAPVINRNLIQKAGYLNLRNKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPTGKAGITLQAESK
KENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQDPSRSSQSRKHS
GLENDKVVPNTPAKVPDADQLIVPGTPIQFDIVLPATEFLDQNRSGRRTNPFGESSDEKN
LNEEDSLLQQMFIVRFLGSMAVKTDSTSEVIYEAMRQVLAARAIHNIFRMTESHLMVTSK
TLRLIDPQTQVTRASFELTSVTQFAAHQENKRLVGFVVRVPESAGEESLSAYVFESNTEG
EKICYAISLGKEIIEAQKDPEALAQLMLSMPLTNDGKFVLLNDQPDSEDGNPNENKAAES
EA
Download sequence
Identical sequences G3W7E7
XP_003771144.1.9362 ENSSHAP00000011352 ENSSHAP00000011352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]