SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011407 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011407
Domain Number 1 Region: 747-961
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-60
Family DBL homology domain (DH-domain) 0.0000000526
Further Details:      
 
Domain Number 2 Region: 947-1100
Classification Level Classification E-value
Superfamily PH domain-like 2.04e-47
Family Pleckstrin-homology domain (PH domain) 0.00000167
Further Details:      
 
Domain Number 3 Region: 645-771
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-24
Family SH3-domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011407   Gene: ENSSHAG00000009807   Transcript: ENSSHAT00000011503
Sequence length 1168
Comment pep:novel scaffold:DEVIL7.0:GL849702.1:592289:675923:-1 gene:ENSSHAG00000009807 transcript:ENSSHAT00000011503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFKKLKSSVLQGIQSREDPDVLNEDASENDLGKHIPNGAVTSVQTSRYSCAGQAVDGG
LSDCSDPEENDDTFLRNTHRSRSIRRAYGIGRINLLDSDKYSGSQLCGRPLSPIIQEPKV
CEILVKNSENNRIIYRRSKSTDNLNFLRKSSFKRKSTSNLTDLKVTNEKHEIQRTLSSPT
DSDKTNGLERRSKRWKSPIRAKDFDRVLKLVSNVADAAWKREPPKSGASSPSELNQRVQL
NSQLHDDYSRRVSTNTEHDRKRSTSPVCNVESSFAVIPSLSPNTSQRTDTDIETKMLPKA
KPLQTSGCVRQSADSSSSSPTALKAFIKDSDKPKNTSQSACELDHPSTPPRPTAPKPQSP
VSENAKYNMNFHCPNTHSTLSLSSMESEERAEVPAPKGRSPVSFQESVKTVYYDDGNEDS
GISSHSQLSLNLATSPEERKEEVVTDEQWRKSSSQDEEKTEPQRVTRRRWGSGKRSRPRP
LSDYSQLTSRSFSIPEDSVAMETQKLDSVDGGNQQNGASSDTSDQNVSLGYSKGCRKRRP
ISVIGGVSFYGNNQREEIENLLTQPVTRPAVPAHQVPPYKAVSARFRPFTFSQSTPIGLD
RVGRRRQMRTSNISTDGAAESSVLVDDNGSEEDYSYEEICQASPRYLQPGGEQLAINELI
SDGNVVYAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWWWGRNEEKEAWFPASFVRLR
VNQEELSENSSSTQGEEQGEDAGKHRQKHSENKDQMRTNVIQEIMNTERVYIKHLKDICE
GYIRQCRKHTGMFTVAQLGTIFGNIEEIYKFQRKFLKDLEKQYNKEEPHLSEIGSCFLQH
QEGFAIYSEYCNNHPGACLELSNLMKQGKYRHFFEACRLLQQMIDIAIDGFLLTPVQKIC
KYPLQLAELLKYTTPEHSDYNNIKAAYETMKNVACLINERKRKLESIDKIARWQVSIVGW
EGLNILDRSSELIHSGELSRITKQGKSQQRTFFLFDHQLVFCKKDLLRRDMLYYKGRIDM
DEMELMDIEDGRDKDYNINVKNAFKIINKSTEEVYLFCAKKQEDKVRWLQACADERRRVK
EDKEMGMEISESQKKLAMLNAQKTNHTKSKGYNGCSVPPPHQSLHPIHQRHITVPTSIPQ
QQVFALAEPKRKPSLFWHTFNKFTPFKK
Download sequence
Identical sequences G3W7K2
ENSSHAP00000011407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]