SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011457 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011457
Domain Number 1 Region: 466-569
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-24
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-23
Family PDZ domain 0.0000102
Further Details:      
 
Domain Number 3 Region: 245-357
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-19
Family PDZ domain 0.033
Further Details:      
 
Domain Number 4 Region: 739-849
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000186
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 5 Region: 570-642
Classification Level Classification E-value
Superfamily SH3-domain 0.000000367
Family SH3-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011457   Gene: ENSSHAG00000009848   Transcript: ENSSHAT00000011553
Sequence length 1154
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841515.1:598381:644039:-1 gene:ENSSHAG00000009848 transcript:ENSSHAT00000011553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGMEELVWEQYTVTLQKKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLL
QENDRVVMVNGTPMEDVPHSFAVQQLRKSGKIAAIVVKRPRKVQLAPLRGSPSMDPDERA
FHVMDDQAEFDGRSARSGYSERSWHSDNGERSRSWENSPERFPHDQCGGRERSYSRERSR
GRSLERGLDQDYRRDQSRGRPINRDVGYDHGYRRNYSPSGECNQRHPANVRYEMKKSHSR
DQLHSRSPTPEIHQPDHMEQHDIERPIDVLLTKSKSSEEYGLRLGSQIFIKEMTRTGLAT
KDGNLHEGDIILKINGTVTENMSLADARKLIEKSRGKLQLVVLRDSKQTLINIPSLHDSD
SEIEVQKLDISEIESNQSFSPDEKRIHSSDFDYNSSNEKLKERTNIREDTSNRLSKMGAT
PTPFKPTSDIPIVPENNKEPKYQEDFLVSHPKAASRTFLRPSSEDEAIYGPNTKMVKFKK
GDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNSQDFRGLVREDAVLCLLE
IPKGEMVTLLVQSRADVYRDILACGRGDSFFIRSHFECEKESPQSLAFTRGEIFRVVDTL
YDGKLGNWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNSGDRADFWRMRGQRSGIKK
NLRKSREDLTAIVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPGVFQT
AKTEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDS
RQGVKAMRQRLNPTSNKSSRKLYDQANKLKKTCAHLFTGTVSLNSANDSWFGSLKDLIQQ
QQGEAVWVSEGKPKLEGMDDDMDDRMSYLTAMGADYLSCDSRLISDFEDTDGEGGAYTDN
ELDEPTEEPQVSSITRSSEPVQHEESIRKPSPEPRGQIRRAASRDQLRDNSPPPAFKPEP
PKAKLQNKDESFDIFKSHEYKTNNSVTTNNEIPGAATKTYAPPVPLKPAFGRSILKPSIF
PSQEKEEDEGNGEETDNTPKSVLGKVKIFEKMDHKARIQRMQELQEAQNARLEIAQKHPD
IYAVPMKAPKPDPSSSQVTSSRPPEPQKLPSRPYQDSRGSYNSDIEEEEYRQQLSEHSKR
GYYGQPARYRDTEL
Download sequence
Identical sequences G3W7Q2
ENSSHAP00000011457 ENSSHAP00000011457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]