SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011548 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011548
Domain Number 1 Region: 2891-3070
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-36
Family Laminin G-like module 0.00000414
Further Details:      
 
Domain Number 2 Region: 2284-2479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.34e-33
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 2714-2882
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-32
Family Laminin G-like module 0.0000826
Further Details:      
 
Domain Number 4 Region: 2112-2285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-28
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 2482-2669
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-28
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 829-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000112
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 7 Region: 779-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000343
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 8 Region: 722-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 9 Region: 1383-1434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 10 Region: 1024-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000865
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 11 Region: 882-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000865
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 12 Region: 252-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 13 Region: 1443-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000561
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 14 Region: 1490-1534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 15 Region: 339-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 16 Region: 379-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000206
Family Laminin-type module 0.047
Further Details:      
 
Domain Number 17 Region: 931-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 18 Region: 53-139
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000119
Family APC10-like 0.078
Further Details:      
 
Domain Number 19 Region: 449-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 20 Region: 684-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000262
Family EGF-type module 0.091
Further Details:      
 
Domain Number 21 Region: 975-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Laminin-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011548   Gene: ENSSHAG00000009924   Transcript: ENSSHAT00000011644
Sequence length 3074
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841312.1:609433:772192:-1 gene:ENSSHAG00000009924 transcript:ENSSHAT00000011644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAILNLASNAHINTNATCGEKGPEMFCKLVEHVPGRPIKNAQCRICDNNSASPKETE
RHPISNAIDGTNNWWQSPSIQNGREFHWVTITLDLRQVFQVAYIIIKAANSPRPGNWILE
RSLDGKKFTPWQYYAISDTECLTRYNITPRLGPPTYKRDDEVICTSYYSRLVPLEHGEIH
TSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTLSHRDPKDLDPIVTRRYY
YSIKDISIGGMCICYGHASSCPWDETTKKLQCQCEHNTCGESCNECCPGFHQQPWRPGTI
SSGNTCEECNCHNKTKDCYYDQSVADRKKSMNTAGHFKGGGVCVNCLQNTAGINCETCID
GYYRPHKVSPYENNPCLPCNCDPFGSLNSVCIKDDRQSDQGNWPGQCQCREGYTGEKCDR
CQFGYKGYPNCFRCNCSLAGSVNDDPCTEPCLCKENVEGEECDRCKPGFYNLKERNPEGC
TECFCFGVSDVCDSLSWPVSQVTDMSGWLVTDLVSSNNVQSQQNQVDEPHQITINNTVAM
QMLKSKYYWSAPPAYLGNKLTAFGGNLKYTVSYDIPMETVDSDLMSHADVIIKGNGLTLS
TRAEGLSLQPYEEYFNVVKLVPENFRDYNTKREIDRDQLMTVLANVTHLLIRANYNTAKK
ALYRLDAVTLDTANPNVIDLVLATDAEHCECPQGYTGISCESCLPGYYRVGGILFGGICQ
PCECHSHATECDIHGVCLTCKHNTAGAHCDQCSPGFYGNPSRGTSEDCQRCACPLTTASN
NFSPTCHLDDGDEVICDQCQPGYTGMWCERCADGYYGNPTVPGETCVPCDCNSNVDPLEV
DHCDTVTGECLKCIGNTEGPHCERCAEGFYGDALVAKNCRACSCHGSSSLSSVCHHETGL
CKCKPNVMGQHCDQCLDGFYGLNTGLGCLPCNCSQLGSVSENCSDEGQCYCVPGVAGQRC
DRCAHGFYAYQDGSCTPCNCPHTQNTCDPESGECICPPHSQGLKCESCEDGYWGRDPELG
CKACNCSSIGSTSHQCDLSTGQCSCREKYGGQSCNECALGFRDYPDCVSCDCEISGTKGE
TCDEKQGVCSCEEESGTCFCKENVFGLHCSECKTGTFALHSDNPLGCSPCFCFGMTRFCS
ELEGYVRIPITLTPDQSILRVVSQSNLEGTIEGVYYQHPEILLDAVAVRQHVNSEPFYWR
LPDQFLGDQLMAYGGKLKYTVAFYSSDGIGTYNLEPQILIKGGRTSKLVIYMNIPAPENG
VRKEQEVDMKENIWKYFNSVSEKPVTHSDFMSVLSNIDYILIKASYGQGLLQSRIANISM
EIGVKAEEMHSKREVAYLLENCDCPPGYAGLSCQDCAPGYHRAKLPEVSVRESRPLIAPC
VPCHCNNHTETCHPETGKCLNCRDNTVGDHCNVCAPGYYGKVLGFTSDCSLCACPRTNAR
YIFSSTCVLEGENDFRCNACSLGYEGQYCEKCSSGFYGNPIKLGGSCQPCDCDPNGSVHS
FCNTTSGQCICKPGVTGHACNECEPRHILVESKCVSCDDECVGVLLNDLDNITDAISSVN
LTGIIPVPHGILSNLENTTKNLRVSASKQIHIEVYIKQVKGNKYNILKILQVLVTFLTQV
LESSQQLNVITEKILKKSQDLATLIEKLRTNIKVIVEEAILLNESWSVNPQLPNATLQNM
REDIESMLEVLQKRNLMQLHQNATAELKAAKNLLMQIQKNYQKPQRDLKELKEKANNYFL
EYSIKLQEAQALVNEADAKTKESNRLLLIITTNLKELNDKKLHVLENQNLSSTLIEKGKG
LIAVIAALAKDAKNATEKLELHRDELLLWSAKIRHHVDELVMQMSKRGALNLVYRAEDHA
AELMRLADLLDRGLTDVRDISLNATNAVHAHSSIQNLIEGAEKLAVEALRKAEITNLSVE
PLLSNGKVALQHGAKLLKEANNLDGKTKGVMSKMNELKKKVNRFQEHAHKLTKQLNDSLL
MLGMMMPDGTWETALKTKEMARAANESSMNTFNDIVDFSHKLLNTSSVLSRVNETLRKTN
QLLSDSSQATVLVERKVKEVKTQANLLFDRLKPLKMLEENLNRNLSEIKELISQARKQAA
SIKVAVSADRDCIRAYQPQISSTNYNTLLLNVKTSEPDNLLFYLGSSASSDFLAVEMRHG
KVAFLWDVGSGSARLEFSDFPINNDKWHRIYITRFGNTASLSIKEMSSTQKPLTKTAKSP
GIANVLDVNESTLMFVGGLGGQIKKSPAVKVTHFKGCMGEASLNGKSIGLWNYIEREGKC
NGCFGSSQNEDSSFYFDGSGYSVVEKTLRSTVTQIIMLFSTFSPNGLLLYLASNGTRDFL
SIELVDGKVKLTVDLGSGPLALITDRRYNNGTWYKIAFQRNKKQGLLAVFDAYNTTSKET
KQGESPGGSSDLNRLNKDPIYVGGLPRTRVVSYFLLFLSRKGLTSRSYVGCIKSLEISRS
TFDLLRNSYGVRKGCLLEPIRSISIFNDGYIELPPKPLSMESELMATFATKNSSGIILAG
FSKGKDKRSRRQAHVPFFSIALIEGHLEVHINPGDGMSTRKATLHSTTGTYSDGQEHSIV
LIRNKRLITVQVDEANHTEMRFGPLAENKIINVSNLYIGGIPEGEGTSVFRMRKSFHGCI
KNLIFNMELLDFTSALSYEQVDMDSCLLSEKPRPVIHGEDVELQPEAHPLSSPTLVQEQC
AVDREVDYVPNAHQFGLALGSHLVLPFNQSAIRKKLSVQLTIRTFALSGLIYYMAHQNQV
DYATLQLHDGQLYFMFDLGKGRTKASHPAFLSDGKWHTVKTEYAKRKGFITIDGQESTMV
TTIGDGTTLDVEGKFYLGGLPLNYRAKNIGNITYGIPACIGEVVINGKQLDKNNPLSASS
VNRCYSMAQEGTFFEGSGFVALVKDGYKVRSDVNITLEFRTTAMNGVLLGISSAKVDAIG
IEIVNGKVSFHVNNGAGRITATYEPKSASSLCDGKWHKVQAHKSKHRIVLIVDGNTVPAE
SPHTQSTSADTNNPIYVGGYPADVKQNCLSSRTSFRGCMRKLTLVKGQQVESIDFSKAFD
IRGVFPHSCPGTEL
Download sequence
Identical sequences G3W7Z3
ENSSHAP00000011548 ENSSHAP00000011548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]