SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011568 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011568
Domain Number 1 Region: 93-176
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000439
Family PDZ domain 0.078
Further Details:      
 
Domain Number 2 Region: 15-72
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000493
Family HtrA-like serine proteases 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011568   Gene: ENSSHAG00000009941   Transcript: ENSSHAT00000011664
Sequence length 333
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841626.1:612872:624209:-1 gene:ENSSHAG00000009941 transcript:ENSSHAT00000011664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGGGGETRRGRSECWEVFSVQENSPAQQAGLEPFFDFIITIGHARLNKESSTLKDLLKA
NMEKPVKLEVYSIKTLRVREVEVVPSNMWGGQGLLGASVRFCSFQRANEHVWHVLDVEPS
SPAALAGLQPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSETDLCREVVVTPN
SAWGGEGSLGCGIGYGYLHRIPTVSPKKPQETGLPAALPPETLSSSPVQGGYTEASLQAP
DSPFDGAPDVLDVDRSAASGSDACPVGTSLQPPPPVQRVMDPGFLDVSGIALLDTTDIAP
LPSTASSVSLPSLGESVMGTESVLPSREPLANN
Download sequence
Identical sequences G3W813
ENSSHAP00000011568 ENSSHAP00000011568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]