SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011655 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011655
Domain Number 1 Region: 251-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 2 Region: 432-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 3 Region: 380-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 4 Region: 317-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 5 Region: 78-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000132
Family N-terminal domain of xrcc1 0.058
Further Details:      
 
Domain Number 6 Region: 535-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011655   Gene: ENSSHAG00000010013   Transcript: ENSSHAT00000011751
Sequence length 1177
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856783.1:623963:688625:-1 gene:ENSSHAG00000010013 transcript:ENSSHAT00000011751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQPFFLLLFPFSLPGLHAQQACSRGACYPPVGDLLVGRTRFLKASSTCGMTKPETYCTPY
GEWKMKCCKCDSRLPHGYNSHRVENVLSSSGPTRWWQSQNDVSPVSLQLDLDRKFQLQDI
MLDLQGPLPAGMLIEHSPDFGKTWKVYQYLAPNCAATFPQLRQGRPQSWQDVRCQPLSTQ
HTGPNRGGKVHLNLLDLASGIPATQSQKIHELGEITNLRINFTRLASVPQRGYHPPSAYF
AVSQLRLQGSCFCHGHADSCAPLPGIPADPSARVQVHEVCVCQHNTAGLTCDRCAPFYNN
RPWKAADDQNPHECQRCECNGHSETCHFDPAVFAASQGVSGGVCDNCQDHTEGNNCERCQ
LHYFRNRRPGAPIQETCIPCECDPDGAVPGAPCDPLTGQCVCKENVKGERCDLCKPGFTG
LTYTNPQGCTRCDCSILGSRRDMPCDEETGRCLCLPNVVGPKCDQCAPNYWKVASGRGCE
PCNCDPHNSYSPQCNQFTGQCQCREGFDGPTCSAASIRQCPDRSYGDSGTACRACDCDFR
GTEGPGCDKTTGQCLCRPGFVGPRCDQCQRGFCDNYPICVVCHSCFQTFDRNIREEALRL
RSLLNITAGLRPGSGLGDHVLGPRIGEAENSIRQIHAILRTPSVTEQEITEVANIIFSFR
RTLQNLQTNLPLEEETDSLLEELENLDRSLKLLLIQYQNKREQFERISSTDPSGSFRMLN
SAYQTSSQAVQRIASSSNLLLQVHDSRKEAERLERQLEGSGSAGGSQLQTLRQQMASFPN
LTPTINKICGTTRQETCTPGQCQGITCPRDNGTACGADCRGILRQAGGAFRIAKQMSQQL
QDFNAQLQQTRQMVHDKIREAEEAATQIQTDAQRLEIQVSNSRSQMEEDVRRTRLLIQQV
RDFLTDPSTDAATIQEISESVLALWLPTDSATVLRKMNEIQAIAARLPNVDLILSQTKQD
ITRARKLQEEAELARSRAITVEGQVEDVVENLRQGMVALQEAEDTMLGTSRSLGLLQDRI
TEVQQVLAPTERMVTGMTEQLTSFRDRIEQLRHSIGEQREQSAQAQEIAQGASEHALSAQ
QGFERVKQKYKELKNRMGQSPMLGEQGSRILNVKSEAEELFEETMTMMDRMKDMEVELLM
GSQDIIRRSADLTGLEKRVEKIRDHINERVLYYATCQ
Download sequence
Identical sequences G3W8A0
ENSSHAP00000011655 ENSSHAP00000011655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]