SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011731 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011731
Domain Number 1 Region: 152-487
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-78
Family Protein kinases, catalytic subunit 0.000000502
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.21e-44
Family Regulator of G-protein signaling, RGS 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011731   Gene: ENSSHAG00000010073   Transcript: ENSSHAT00000011827
Sequence length 530
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864873.1:632945:735760:-1 gene:ENSSHAG00000010073 transcript:ENSSHAT00000011827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKLPHVNHCIELRHSIEQDYNSLCDKQPIGRLLFRQFCDTKLDLKKCIEFLDAVAEYEV
ASDENRRETALKVLDTYFNNGSAAHLPEIPQDIVKECKERLEQSPCKELFKDCTRVVHDY
LSGRPFEEYQESLFFSRFLQWKWLERQPVTKNTFRHYRVLGKGGFGEVCACQVRATGKMY
ACKKLEKKRIKKRKGESMALNEKKILEKVHSRFVVSLSYTYETKDALCLVLTIMNGGDLK
FHIYNMGNPGLDEERAIFYAAELCCGLEDLQRERIVYRDLKPENILLDDREIGHIRISDL
GLAMQIPEGETIRGRVGTIGYMAPEVINNENYTFSPDWWGLGCLIYEMIQGQSPFRKRKE
KVKREEVDRRVKEDQEEYSEKFSEEAQSICRMLLEKDPRKRLGCKGEGAAGVKLHPIFKN
INFKRLEANMLDPPFSPDPRAVYCKDVLDIEQFSTVKGVNLDTTDDDFYSKFVTGCVSIP
WQNEMIETECFKDINTFENDNLTSDLDVNKHTPRHTPRPKRGFFHRLFRR
Download sequence
Identical sequences G3W8H6
ENSSHAP00000011731 ENSSHAP00000011731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]