SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011829 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011829
Domain Number 1 Region: 58-851
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.48e-291
Family Motor proteins 1.56e-16
Further Details:      
 
Domain Number 2 Region: 852-977
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.14e-22
Family Myosin rod fragments 0.00033
Further Details:      
 
Domain Number 3 Region: 972-1087
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.53e-21
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 4 Region: 1258-1365
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.02e-17
Family Myosin rod fragments 0.0035
Further Details:      
 
Domain Number 5 Region: 1075-1167
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000107
Family Myosin rod fragments 0.0039
Further Details:      
 
Domain Number 6 Region: 1364-1466
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000549
Family Myosin rod fragments 0.0078
Further Details:      
 
Domain Number 7 Region: 1663-1764
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000113
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011829   Gene: ENSSHAG00000010154   Transcript: ENSSHAT00000011926
Sequence length 1769
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861606.1:643672:688962:-1 gene:ENSSHAG00000010154 transcript:ENSSHAT00000011926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASKMAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSEKNGFEPASLKEEVGDEAIV
ELIENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGL
FCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGES
GAGKTENTKKVIQYLAYVASSHKSKKDQNESRGPCSLTSEGELERQLLQANPILEAFGNA
KTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGA
GEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMFQETMEAMRIMSIPEEEQMGLLKVIS
GVLQLGNIAFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKA
QTKEQADFAIEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFDLNSF
EQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGI
LALLDEECWFPKATDKSFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEW
LMKNMDPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFR
TVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRIC
RQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFR
AGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRN
WQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVKEKQLAAENRLVEMETLQSQLMAEKLQ
LQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQN
IQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLEDRISEF
TTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQI
AELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNLALKKIRELESQISELQEDLESER
AARNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLDDEAKTHE
AQIQEMRQKHSQAVEELAEQLEQTRRVKANLEKAKQALENERTELSNEVKALLQGKGDSE
HKRKKVETQLQELQVKLTEGDRVRTELADKVTKLQVELDNITGLLNQSDSKSSKLAKDFS
ALESQLQDTQELLQEETRQKLSLSTKLKQTEDEKGTLREQLEEEEEAKRNLEKQIATLHA
QVADMKKKMDDGVGCLESVEEAKRKLQKDLEGVSQRYEEKAAAYDKLEKTKTRLQQELDD
LLVDLDHQRQIVSNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARA
LEEAIEQKAELERLNKQFRAEMEDLMSSKDDVGKSVSPGILWSPRCPPAQMKDYMRELDD
TRASREEILAQSKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGK
GALALEEKRALEARIAQLEEELEEEQSNTELVNDRLKKANLQIDQINTDLNMERSHSQKN
ENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQ
VRRAEKKLKDVILQVDDERRNAEQYKDQV
Download sequence
Identical sequences G3W8S4
ENSSHAP00000011829 ENSSHAP00000011829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]