SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011860 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011860
Domain Number 1 Region: 133-381
Classification Level Classification E-value
Superfamily vWA-like 1.48e-82
Family Integrin A (or I) domain 0.0000000215
Further Details:      
 
Domain Number 2 Region: 377-467
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-27
Family Integrin domains 0.00012
Further Details:      
 
Domain Number 3 Region: 633-717
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.96e-21
Family Integrin beta tail domain 0.00022
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000282
Family Plexin repeat 0.00064
Further Details:      
 
Domain Number 5 Region: 591-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Integrin beta EGF-like domains 0.0014
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number 7 Region: 88-156
Classification Level Classification E-value
Superfamily Integrin domains 0.000023
Family Integrin domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011860   Gene: ENSSHAG00000010179   Transcript: ENSSHAT00000011957
Sequence length 800
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849584.1:647393:862560:-1 gene:ENSSHAG00000010179 transcript:ENSSHAT00000011957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRLWPLSACLLVFCILLPQSPGLNICTSGSATSCEECLLINPKCAWCSKEDFGNLRSV
TSRCDLRANLLKNGCGGEIESPESSIVVLKSLPLSIKGSSPANSDVIQMTPQKIAMNLRP
GDKTPFRVQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLAEEMRKLTSNFRLGFG
SFVDKNISPFSYTAPRYQTNPCIGYKLFPHCVPSFGFRHLLSLTDEVDSFNEEVKKQRVS
RNRDAPEGGFDAILQAAVCKEKIGWRKEALHLLVFTSDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASKQMDYPSLALLGEKLAENNIHLIFAVTKNHYMLYKNFTALIPGTTVEIL
HADSRNIIQLIVNAYNSIRSKVELSVWDNPEDLGLTFTATCQDGLSYPGQRKCGDLKIGD
TVSFEVSVEARSCPAKDTVHTFTLRPVGFRDTLELVVTYNCLCSCTNRTEQDSLRCSGNG
TYTCGTCECYPSYLGSKCECQEGENRDLYQNLCRETEGKPLCSGRGECSCNQCSCYESEF
GKIYGSFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTETETCLSNDGQ
ICSGRGYCSCGRCQCTKPGAFGETCEKCPTCPDACSTKRDCVECMLFNSGRLADNQTCQK
HCRDEVITRVDSIPKDDQEAVLCFYKTAKDCVMMFTYSELPSGKSKLMVLKEPECGSAPS
AMTILLAVVGSILLIGIALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIS
THTVDFTFNKLNKSYNGTVD
Download sequence
Identical sequences G3W8V5
ENSSHAP00000011860 XP_012400023.1.9362 ENSSHAP00000011860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]