SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011861 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011861
Domain Number 1 Region: 722-936
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-106
Family Thrombospondin C-terminal domain 0.000000114
Further Details:      
 
Domain Number 2 Region: 595-720
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.96e-33
Family TSP type-3 repeat 0.00000557
Further Details:      
 
Domain Number 3 Region: 217-262
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 9.15e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 34-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000352
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 5 Region: 526-597
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000719
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 6 Region: 460-538
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000235
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 7 Region: 366-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family EGF-type module 0.02
Further Details:      
 
Domain Number 8 Region: 284-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000452
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011861   Gene: ENSSHAG00000010181   Transcript: ENSSHAT00000011959
Sequence length 956
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841174.1:647504:700252:-1 gene:ENSSHAG00000010181 transcript:ENSSHAT00000011959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPTLKAAFLFLHIFLQSWPGFGAQAAPQVFDLLSSSNQKLVTSFLKPILMDPTLNEVYV
MSTFKLHTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKADGKIHLVVFNNIQLA
DGKRHRLLLRLSNFQRGSSSVELYLDCNQVDTIQDLPRAFSGLSHSSEPVELRTFQRKAQ
DTLEELKLVVRGSLFQVASLQECFFQQSDHVPTSSTGDVNWQILGQMTQLNKLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSLHSPTPNTIPTPATLLHRCDSNPCFRGVRCTDTRD
GFQCGPCPEGYTGNGVTCSDIDECTFNPCFRGVRCLNLSPGFRCDSCPVGFTGPMVQGVG
VTFAKTHKQICSDIDECRNGACVPNSICINTVGSYQCGPCKSGFTGDQIRGCKTEQNCRN
PELNPCSVNAQCIEERQGGVTCVCGVGWAGDGFICGKDIDIDSYPDEELPCSGRNCKKDN
CKYVPNSGQEDADRDGIGDACDEDADGDGINNEQDNCVLTHNVDQRNSDQDIFGDACDNC
RTVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCQKVPNRDQRDKDNDGVGDACDSCP
DVSNPNQSDIDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSSQLDTDKDGLGDECDDD
DDNDGIPDVIPPGPDNCRLVPNPTQEDVNRDGVGDICEADFDQDQVIDRIDVCPENAEVT
LTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFH
VNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPG
EHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFFEGSELVA
DSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNADTIPEDFQEFQTQNFDRIDN
Download sequence
Identical sequences G3W8V6
ENSSHAP00000011861 ENSSHAP00000011861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]