SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011948 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011948
Domain Number 1 Region: 298-563
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-52
Family YWTD domain 0.0000023
Further Details:      
 
Domain Number 2 Region: 927-1172
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-46
Family YWTD domain 0.0000156
Further Details:      
 
Domain Number 3 Region: 613-874
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-29
Family YWTD domain 0.000038
Further Details:      
 
Domain Number 4 Region: 201-290,564-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000141
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 3-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 43-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 7 Region: 90-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 8 Region: 883-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000326
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 172-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000956
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 10 Region: 137-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 11 Region: 1191-1240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000712
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011948   Gene: ENSSHAG00000010252   Transcript: ENSSHAT00000012046
Sequence length 1314
Comment pep:novel scaffold:DEVIL7.0:GL849612.1:656023:905964:-1 gene:ENSSHAG00000010252 transcript:ENSSHAT00000012046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFPTCEPLTQFICKNGRCISSKWHCDSDDDCGDGSDEVGCIHSCSDNQFRCSSGRCIPEH
WACDGDNDCGDFSDETKANCTKEEIHSPAGCNGNEFQCDPDGNCVPDLWRCDGEKDCEDG
SDEKGCNGTVRLCDEKTKFSCKRTGRCINKAWVCDGDIDCEDQSDEDDCESFLCGPPKYP
CANDTSICLQPEKLCNGRKDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGRGIVCSCPSG
LQLNPDNKTCEIVDYCSRHLKCSQVCEQHKYSVKCSCYEGWKLNMDGESCTSIDPFEAFI
IFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESGG
VGAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGTLRTTLIAGAMEHPRA
IALDPRYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVWT
DARSDAIYSALYDGTGMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQN
VSVIQKTSAQPFDLQIYHPSRQPQAPNPCEANEGKGPCSHMCLINHNRSAACACPHLMKL
SPDKKTCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYW
TDIKTQTIKRAFINGTGLETVISRDIQSIRGLAVDWISRNLYWISSEFDETQINVARLDG
SLKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKDPVGKKLSI
CSIANKFFWISDGRGLFNECIIKGGNIQDILETWKEDNYLLKKYPAIFPDKKLWWADQNL
AQLGTCSKRDGRNPTVLRNKTSGVVHMKVYDKETQRGKSHCSNSCQLNNGGCSQLCLPTS
ETTRTCMCTVGYNLRKNRMSCQGIESFLMYSVHEGIRGIPLEPTDKMDALMPISGTSFAV
GIDFHAENDTIYWTDMGFNKISRAKRDQTWKEDIITNGLGRVEGIAVDWIAGNIYWTDHG
FNLIEVARLNGSFRYVIISQGLDQPRSLALHPEKGYLFWTEWGQNPCIGKARLDGSEKVI
LVSMGIAWPNGVSIDYEENKLYWCDARIDKIERIDLESGGNREIVLSGSNVDMFSVAVFG
AYIYWSDRAHANGSIRRGHKNDATDAVTMRTGLGVNLKEVKVFNRVREKGTNVCAKDNGG
CQQLCLYRGNSQRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPVR
PYENPHYFKNVIALAFDYSLRRKGTNRIFYSDAHFGNIQLIKDNWEGRQVIVES
Download sequence
Identical sequences G3W943
ENSSHAP00000011948 ENSSHAP00000011948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]