SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011972 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011972
Domain Number 1 Region: 41-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000032
Family EGF-type module 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011972   Gene: ENSSHAG00000010271   Transcript: ENSSHAT00000012070
Sequence length 159
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834703.1:658901:773925:1 gene:ENSSHAG00000010271 transcript:ENSSHAT00000012070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTPAGELALIGIGILLAVCQALENTTSALNGPPMAAAVVSHFHDCPDSHSQFCFHGTCR
FLVEEEKPACKCHSGYVGARCEHADLLAVVAANQKKQTITALVVVSIVALVVLIGICVLI
HCCRIRRPCEWCRGFVCQHEKPSDLLKGGTTCCRSETVV
Download sequence
Identical sequences G3W967
ENSSHAP00000011972 ENSSHAP00000011972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]