SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011973 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011973
Domain Number 1 Region: 21-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000251
Family EGF-type module 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011973   Gene: ENSSHAG00000010271   Transcript: ENSSHAT00000012071
Sequence length 142
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834703.1:754130:770582:1 gene:ENSSHAG00000010271 transcript:ENSSHAT00000012071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSTPFLVPAGPPMAAAVVSHFHDCPDSHSQFCFHGTCRFLVEEEKPACKCHSGYVGAR
CEHADLLAVVAANQKKQTITALVVVSIVALVVLIGICVLIHCCRIRRPCEWCRGFVCQHE
KPSDLLKGGTTCCRSETGCILF
Download sequence
Identical sequences G3W968
ENSSHAP00000011973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]