SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012321 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012321
Domain Number 1 Region: 28-145
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-31
Family C-type lectin domain 0.00000343
Further Details:      
 
Domain Number 2 Region: 307-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.67e-17
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 3 Region: 433-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.89e-16
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 4 Region: 496-566
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.45e-16
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 5 Region: 369-443
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 246-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 552-617
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 8 Region: 184-255
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000598
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 147-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000887
Family EGF-type module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012321   Gene: ENSSHAG00000010556   Transcript: ENSSHAT00000012421
Sequence length 680
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856751.1:706052:718829:-1 gene:ENSSHAG00000010556 transcript:ENSSHAT00000012421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKMMTVLSFLLGLIYAFLLFERSDAWLYASSEVNMTYEQARKYCQERYTDLVAIQNKN
EIEYLNRTLRFSPSYYWIGIRKINGVWTWVGTQKPLTKEAMNWAPNEPNNKQNNEDCVEI
YIKRKKDSGMWNDERCTKEKLALCYTASCTSNSCNGHGECVETINNFTCQCYPGFTGSQC
EHVVTCESQANPEHGVLTCSHPVGYFNSSCSVSCEEGYIPTSANSVQCTSSGKWSGPSPT
CKVVECDALTSPAHGSMNCSQSPGIFPWNTTCVFDCDSGFELTGSKRLHCNSSGKWDMEK
PMCQAMKCNAPSQLPNGSVNCVHSPIGDFTYQSICSFSCEEGFKLQGSPQLECTAQGQWT
QQFPTCEAIQCKIPSRPERGYMDCLPSLSGSFQSGSSCEFSCEEGFMLKGSKRLQCDLTG
QWDKEEPVCEVMKCDAVSQPQNGFMKCAHSPTGDFTYQSICSFSCEKGFELQGSSQLECS
AQGQWTQQMPTCEAMKCDAVSQPQNGFMKCAHSPTGDFTYQSICSFSCEEGFALQGSPQL
ECTAQGQWTQQMPTCEVVQCPILKVPKEINMTCHGDGNFLYGTRCVFECPEGWKLNGSHS
LACKATGSWSGMLPSCEAPEKSNTSMVVGLATSGTFLLSTASFLLWLIKRLRNKAKKFSP
TSSCQSLDLDGVYQASSELV
Download sequence
Identical sequences G3WA66
ENSSHAP00000012321 ENSSHAP00000012321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]