SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012322 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012322
Domain Number 1 Region: 30-147
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-31
Family C-type lectin domain 0.00000343
Further Details:      
 
Domain Number 2 Region: 309-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-17
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 3 Region: 435-505
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.59e-16
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 4 Region: 371-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 241-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 491-556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 7 Region: 186-257
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 149-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000792
Family EGF-type module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012322   Gene: ENSSHAG00000010556   Transcript: ENSSHAT00000012422
Sequence length 619
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856751.1:706052:718829:-1 gene:ENSSHAG00000010556 transcript:ENSSHAT00000012422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRMVSKMMTVLSFLLGLIYAFLLFERSDAWLYASSEVNMTYEQARKYCQERYTDLVAIQN
KNEIEYLNRTLRFSPSYYWIGIRKINGVWTWVGTQKPLTKEAMNWAPNEPNNKQNNEDCV
EIYIKRKKDSGMWNDERCTKEKLALCYTASCTSNSCNGHGECVETINNFTCQCYPGFTGS
QCEHVVTCESQANPEHGVLTCSHPVGYFNSSCSVSCEEGYIPTSANSVQCTSSGKWSGPS
PTCKVVECDALTSPAHGSMNCSQSPGIFPWNTTCVFDCDSGFELTGSKRLHCNSSGKWDM
EKPMCQAMKCNAPSQLPNGSVNCVHSPIGDFTYQSICSFSCEEGFKLQGSPQLECTAQGQ
WTQQFPTCEAIQCKIPSRPERGYMDCLPSLSGSFQSGSSCEFSCEEGFMLKGSKRLQCDL
TGQWDKEEPVCEAMKCDAVSQPQNGFMKCAHSPTGDFTYQSICSFSCEEGFALQGSPQLE
CTAQGQWTQQMPTCEVVQCPILKVPKEINMTCHGDGNFLYGTRCVFECPEGWKLNGSHSL
ACKATGSWSGMLPSCEAPEKSNTSMVVGLATSGTFLLSTASFLLWLIKRLRNKAKKFSPT
SSCQSLDLDGVYQASSELV
Download sequence
Identical sequences G3WA67
ENSSHAP00000012322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]