SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012458 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012458
Domain Number 1 Region: 75-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000007
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 33-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012458   Gene: ENSSHAG00000010669   Transcript: ENSSHAT00000012560
Sequence length 352
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841299.1:726737:849332:1 gene:ENSSHAG00000010669 transcript:ENSSHAT00000012560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVLEGKKKLVLSPQKKCCKGYKFILGQCIPEDYDVCSEAPCEQQCTDNFGRVLCTCYPG
YRYDRERHRNKVKPYCLDIDECATSNETLCSQICINSLGSYRCECREGYILEEDGRTCTK
GDKDFGNDRGHDEKVQNALKAETCCATCKEFHQMKQMVLQLKQKIALLPNNAADLGKHVT
VDKLLASNTYLPGPPGQPGGQGPPGSPGPKGSPGFPGVPGPPGQPGPRGSMGPIGPSPDL
SHIKQGRRGPVGPPGAPGRDGSKGERGAPGPKGSPGPPGSFDFLLLMMADIRNDIAELQE
KVFGHRTHSSAEEFPLPQEFSNYPDVLDFGSGEDYPKRTETRDSRIDKDLYP
Download sequence
Identical sequences G3WAK3
ENSSHAP00000012458 ENSSHAP00000012458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]