SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012460 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012460
Domain Number 1 Region: 74-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000464
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 2 Region: 33-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012460   Gene: ENSSHAG00000010669   Transcript: ENSSHAT00000012562
Sequence length 346
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841299.1:726737:849332:1 gene:ENSSHAG00000010669 transcript:ENSSHAT00000012562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVLEGKKKLVLSPQKKCCKGYKFILGQCIPEDYDVCSEAPCEQQCTDNFGRVLCTCYPG
YRYDRERHRNKVKPYCLDIDECATSNETLCSQICINSLGSYRCECREGYILEEDGRTCTK
GDKGHDEKVQNALKAETCCATCKEFHQMKQMVLQLKQKIALLPNNAADLGKHVTVDKLLA
SNTYLPGPPGQPGGQGPPGSPGPKGSPGFPGVPGPPGQPGPRGSMGPIGPSPDLSHIKQG
RRGPVGPPGAPGRDGSKGERGAPGPKGSPGPPGSFDFLLLMMADIRNDIAELQEKVFGHR
THSSAEEFPLPQEFSNYPDVLDFGSGEDYPKRTETRDSRIDKDLYP
Download sequence
Identical sequences G3WAK5
ENSSHAP00000012460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]