SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012468 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012468
Domain Number 1 Region: 13-215
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-52
Family DBL homology domain (DH-domain) 0.00000176
Further Details:      
 
Domain Number 2 Region: 202-369
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-32
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 489-590,667-693
Classification Level Classification E-value
Superfamily SH2 domain 2.33e-25
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 4 Region: 619-695
Classification Level Classification E-value
Superfamily SH3-domain 1.29e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 5 Region: 396-483
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012468   Gene: ENSSHAG00000010676   Transcript: ENSSHAT00000012570
Sequence length 699
Comment pep:novel scaffold:DEVIL7.0:GL834654.1:728102:823958:-1 gene:ENSSHAG00000010676 transcript:ENSSHAT00000012570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPKIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMNPLKLVLSPLDMTAIF
INLEDLIKVHNSFLRAIDVSMMAGGSSLAKVFLEFKERLLIYGEYCSHMEYAQNTLNHLI
ANREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKE
ALEAMQDLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHT
KQDRYLFLFDKVVIVCKRKGYNYELKEIIELLFHKMTDDPMNNKDIKKSHGKMWSYGFYL
IHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPEKANANHHNFQMYTFDKTTNCKACK
MFLRGTFYQGYLCTKCGVGAHKECLEVIPPCKISSPVDPDALNTGADPGPKMVAVQNYHG
IPAPPGKPVLTFQTGDVIELLRGDPESQWWEGRLIQTKKSGYFPSSSVKPCPVDGRPPSS
RPLSREIDYTTYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKH
IKVVEKDNWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRAST
RSPASCASYNFSFLSPQGLGFASQSSSTPFWSVFTPRVIGTAVARYNFAARDMRELSLRE
GDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGVQ
Download sequence
Identical sequences G3WAL3
ENSSHAP00000012468 ENSSHAP00000012468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]