SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012476 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012476
Domain Number 1 Region: 10-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.66e-54
Family G proteins 0.00000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012476   Gene: ENSSHAG00000010682   Transcript: ENSSHAT00000012578
Sequence length 205
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834743.1:729950:769189:-1 gene:ENSSHAG00000010682 transcript:ENSSHAT00000012578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLG
LYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIG
TQIDLRDDPKTLARLNDMKEKPVCVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAII
AILTPKKHTVKKRIGSRCINCCLIT
Download sequence
Identical sequences F7ESZ6 G3WAM1 Q8R527 Q9JJL4
ENSMUSP00000024956 ENSMUSP00000024956 ENSRNOP00000020822 ENSMODP00000001150 10090.ENSMUSP00000024956 10116.ENSRNOP00000020822 13616.ENSMODP00000001150 ENSRNOP00000020822 ENSSHAP00000012476 ENSMUSP00000024956 NP_445974.1.100692 NP_445974.1.4139 NP_663466.2.92730 XP_001375613.1.35504 XP_004699814.1.18182 XP_005354763.1.66349 XP_006839485.1.41390 XP_006861402.1.41390 XP_012395695.1.9362 XP_021073516.1.100879 XP_021499253.1.76796 ENSMODP00000001150 ENSSHAP00000012475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]