SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012632 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012632
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.59e-85
Family Integrin A (or I) domain 0.0000000525
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 2.67e-23
Family Integrin domains 0.00032
Further Details:      
 
Domain Number 3 Region: 622-703
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-16
Family Integrin beta tail domain 0.0013
Further Details:      
 
Domain Number 4 Region: 20-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000162
Family Plexin repeat 0.00093
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Integrin beta EGF-like domains 0.0017
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Integrin beta EGF-like domains 0.0094
Further Details:      
 
Domain Number 7 Region: 82-154
Classification Level Classification E-value
Superfamily Integrin domains 0.0000246
Family Integrin domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012632   Gene: ENSSHAG00000010811   Transcript: ENSSHAT00000012736
Sequence length 788
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849627.1:751871:847384:-1 gene:ENSSHAG00000010811 transcript:ENSSHAT00000012736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLGRNNHVQGSCTVGNAETCEDCLLIGPHCSWCSQEDFTHPSGIGERCD
TPENLLAKGCLLHAIENPTSTIEILRNKPLSIGSQKNNSDIIQISPQKLVLKLRPGNEKT
LQVHVRQTEDYPVDLYYLMDLSASMEDDLNTIKELGSTLSKEMSKLTSNFKLGFGSFVEK
PVSPFIKTTPEELVNPCSSVPHFCLPTFGFKHILPLTSDAEKFNEIVKKQKISANIDTPE
GGFDAIMQAAVCKEQIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGVCHLDSKNE
YSMSTVLEYPTIGQLIEKLVQNNVLLIFAVTKEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIITAYKELRSEVELEVLGDTEGLSLSFTAICNNGTIFPHQKKCSHIKVGGTATFNVT
VNLSTCEKRSRHITIKPVGLADALEIEISPQCSCNCQKDMEENSFKCSRGNGTFQCGVCV
CNPGYMGPLCECDENALSTDSCKDALGHASCSGRGDCYCGQCICHLSTYGQVYGTYCECD
NFSCVRHKGLICGDNGLCDCGECICNSGWTGEYCNCTTSTDSCLSEDGMLCSGRGNCTCG
KCVCTYPGASGPRCEQCPTCGDPCNSKRSCIECHLSPDDRSKAECVDKCKLVDATISDED
FSKENSVSCSLQGENDCLITFLMTTNKEGRTVLHSINQKDCPKLPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHQEKQK
RNITADFH
Download sequence
Identical sequences G3WB27
ENSSHAP00000012632 ENSSHAP00000012632 XP_003763949.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]