SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012663 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012663
Domain Number 1 Region: 484-610
Classification Level Classification E-value
Superfamily TIMP-like 6.02e-28
Family Netrin-like domain (NTR/C345C module) 0.063
Further Details:      
 
Domain Number 2 Region: 314-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000112
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 3 Region: 244-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000523
Family Laminin-type module 0.052
Further Details:      
 
Domain Number 4 Region: 377-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012663   Gene: ENSSHAG00000010838   Transcript: ENSSHAT00000012767
Sequence length 610
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861598.1:756378:891797:-1 gene:ENSSHAG00000010838 transcript:ENSSHAT00000012767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSGVTGVGSHCEKACNPRMGNLALGRRLWADTTCGRNSTELYCSYSENTDLTCKPPKCD
KCNAAHPHLAHLPSSMADSSFRFPRTWWQSAEDAHREKIQLDLETAFYFTHLIMVFKSPR
PAVMVLERSQDFGKTWKPYKYFAANCSATFGLEDDVFEKGAICTSRYSSPFPCTRGEVIY
RALSPPYSAEDPYSASAQDQLKITNLRVQLLKRQPCPCQGNDLNAKPQHFTHYAIYDFIV
KGSCFCNGHADHCGPTDGFRPVKVAGAFQVVHGKCTCKHNTAGSHCQHCAPLYNDRPWQA
ANGKTGAPNECRTCKCNGHADTCHFDKDVWRASGNRSGGVCDNCQHNTEGQHCQRCKPGF
YRDLRRPFSAPDACKLCSCHPTGSAVLPFGSAPFCDPSNGDCPCKPGVAGPHCDKCMVGY
WGFGEYGCRPCDCAGSCDPLTGDCISSSADIDWYHELPDFHPVFNQSEPAWEWEDEQGFS
ALRHSGKCECKEQSLGNPKIFCGMKYSYVLKIKILSAHDKGSHAEVNVKIKKVLKSNKLK
ILRGKRTLYPESWTNRGCTCPILNPGLEYLIAGHEDVRTGRLVVNMKSFVQHWKPALGRR
VMEILKRDCK
Download sequence
Identical sequences G3WB58
ENSSHAP00000012663 ENSSHAP00000012663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]