SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012723 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012723
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.03e-22
Family PB1 domain 0.00000893
Further Details:      
 
Domain Number 2 Region: 222-269
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000247
Family ZZ domain 0.012
Further Details:      
 
Domain Number 3 Region: 968-1005
Classification Level Classification E-value
Superfamily UBA-like 0.00000000408
Family UBA domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012723   Gene: ENSSHAG00000010888   Transcript: ENSSHAT00000012827
Sequence length 1016
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856823.1:763402:789256:-1 gene:ENSSHAG00000010888 transcript:ENSSHAT00000012827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQVNLNVTFKNETQSFLVSDSENTTWADVEAMVKVSFDLNTIQIKYLDEDSEEVSINS
QGEYEEALKIAVKQGNQLQMNVYERHSTVDETPQPGYKHPQDPPGIEKRPTVRAGKKPLA
HYSSLVRALGSEMKTQEEPTAQLSLTPCEADKPQDKPPDWFTRYLETFREQVVKETVEKL
DQKLREKLVLQGPSLESCSSALSMPVAEEALSLPGNQCDWLMTCSNCQRRIIGIRYQCSL
CPSYNICELCEAGSYAHDPNHILLKLRRPIMGSSETYTHTKLSPPRLPAALEQVRLQKQM
DKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLH
SSTLMLPMQPCAPVVPTLSAAFVDENVPDGTHLQPGTKFIKHWRMKNTGNVKWSAETKLK
FMWGNLTLASTEKKDVLVPYLKAGHVGIVSVEFIAPALEGTYTSHWRLSHKGEQFGPRVW
CSIIVDPFPTRENLEDSEKVSFSTNKVDDLSCQQEETFSLAKEEIQIDEVIESTEEAETC
LPRKIKSVPSERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLP
HDSPLIEKPGLGQIQEESEGTGFKVLPDSTMASKTKAENTVPAEEGEEDLSGTQFVCETV
IRSLTLDAAPDHNPPRRPKSLQSSLHMLPDNFNYGIKSEETIRTQFSSLEGESQPQLIEE
RQPAQSDGFSKEKSSSNSILPEERLRSDEKKDTIQLVEEEEEEEEELKDEVRSQGSSASS
EDYIIILPECFDTSRPLGESMYSSALSQPGLERLMEIEQVVKAEQEPAEAYEGLDRGENQ
LQGHSISDILTTSQTLDAVLLTPELVGPPRQLSSPSSLQNINSAETDLPVTIQEFSPVPD
QVRGEPRASSGLVNNRQKNYENSRYYHGSSITGGLVKGAMSFAASAYKALFAGPPVTAQP
IVSEDQTAVLMAHLFEMGFCDRQLNLRLLKKHNHNVLQVVTELLQINNNDWYTHRY
Download sequence
Identical sequences G3WBB8
ENSSHAP00000012723 ENSSHAP00000012723 XP_012403702.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]